HHsearch alignment for GI: 254780724 and conserved domain: PRK10895

>PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional.
Probab=97.18  E-value=0.00056  Score=46.42  Aligned_cols=42  Identities=21%  Similarity=0.254  Sum_probs=36.1

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        23 sl~i~~Gei~~liGpNGaGKSTLl~~i~Gl~~~~~G~I~i~g   64 (241)
T PRK10895         23 SLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDD   64 (241)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECC
T ss_conf             789839979999889998699999999678888876277634