HHsearch alignment for GI: 254780724 and conserved domain: PRK11288

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional.
Probab=95.41  E-value=0.02  Score=35.64  Aligned_cols=163  Identities=19%  Similarity=0.235  Sum_probs=66.9

Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCEEEEECCCCEEEEECCEEEECCCC--CCCHHHHHHHHHHHH
Q ss_conf             741877896789999999999885656335885883321799856991899827838971762--079899999999999
Q gi|254780724|r   99 SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGIN--FRDNEQLLSVCQRIV  176 (483)
Q Consensus        99 ~~~~~~~~~~~~~~l~~~i~~e~~glGpL~~ll~D~~VsdI~ing~~~I~ve~~G~~~~~~~~--f~~~~~l~~~i~rla  176 (483)
T Consensus       165 DEPts~LD~~~~~~l~~-~l~~l~~~G~t-il~isH~l~~~~-~~~Drv~vl~~G~iv~~~~~~~~~~~~~---l~~---  235 (501)
T PRK11288        165 DEPTSSLSAREIEQLFR-VIRELRAEGRV-ILYVSHRMEEIF-ALCDAITVFRDGRYVATFDDMAQVDRDR---LVQ---  235 (501)
T ss_pred             CCCCCCCCHHHHHHHHH-HHHHHHHHCCC-EEEECCCHHHHH-HHCCEEEEEECCEEEEECCCHHHCCHHH---HHH---
T ss_conf             58745689899999988-99999872761-265133289999-7588789711885997637213379999---999---


Q ss_pred             HHHCCCCCCC-----CCEEEEEECCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHHHHC-CC
Q ss_conf             9809812433-----87787982376203453155357881688840576546678886506998899999898622-58
Q gi|254780724|r  177 NQVGRRVDES-----SPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR-IR  250 (483)
Q Consensus       177 ~~~g~~i~~~-----~P~~d~~lpdg~Ri~~~~~p~s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~-~~  250 (483)
T Consensus       236 ~~~~r~~~~~~~~~~~~~~~~~l----~~~~l~~~~~~~~vsl~v~~--GEivgiv--G~nGsGKSTL~k~L~Gl~~p~~  307 (501)
T PRK11288        236 AMVGREIGDIYGYRPRPLGDVRL----RLKGLKGPGLREPISFAVRR--GEIVGFF--GLVGAGRSELMKLLYGATRRTA  307 (501)
T ss_pred             HHHCCCHHHCCCCCCCCCCCEEE----EEEECCCCCCCCCEEEEEEC--CEEEEEE--CCCCCCHHHHHHHHCCCCCCCC
T ss_conf             86285535405878888774379----99850378745663478708--8399975--6888648799998438748876


Q ss_pred             CCEEEECCCCCCHHH--HHHHHHHHCCCCC
Q ss_conf             848998188888889--9999983038767
Q gi|254780724|r  251 CNVLISGGTGSGKTT--LLNCLTRYIDKDE  278 (483)
Q Consensus       251 ~nilVsG~TGSGKTT--~L~al~~~i~~~~  278 (483)
T Consensus       308 G~I~~~G~~i~~~~~~~~~~~gi~~vp~dr  337 (501)
T PRK11288        308 GQVYLDGKPVDIRSPRDAIRAGIMLCPEDR  337 (501)
T ss_pred             CEEEECCEECCCCCHHHHHHCCEEEECCCC
T ss_conf             659999998887797899861778601200