HHsearch alignment for GI: 254780724 and conserved domain: PRK11388

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional.
Probab=96.17  E-value=0.011  Score=37.35  Aligned_cols=59  Identities=19%  Similarity=0.283  Sum_probs=38.1

Q ss_pred             CCCCHHHHHHCCCCCHHHHHH---HHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCC-CCCEEEE
Q ss_conf             546678886506998899999---8986225884899818888888999999830387-6767999
Q gi|254780724|r  222 DKLTLDHLVSFGAVTAEGARL---LQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK-DERIVTC  283 (483)
Q Consensus       222 ~~~~l~~l~~~g~~~~~~~~~---l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~-~~rivtI  283 (483)
T Consensus       320 ~~~~f~~l~g---~s~~~~~~~~~a~~~a~~~~pVLI~GE~GtGKe~lAraIH~~S~r~~~pfv~v  382 (639)
T PRK11388        320 VSHTFDHMPQ---DSPQMRRLIHFGRQAAKSSFPILLCGEEGVGKALLAQAIHNESERAAGPYIAV  382 (639)
T ss_pred             CCCCHHHCCC---CCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             8888554467---99999999999999968899689889898109999999995577789981898