HHsearch alignment for GI: 254780724 and conserved domain: PRK11432

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional.
Probab=97.08  E-value=0.0024  Score=42.00  Aligned_cols=42  Identities=19%  Similarity=0.237  Sum_probs=34.5

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        26 sl~i~~Ge~~~llGpSG~GKTTlLr~iaGl~~p~~G~I~~~g   67 (351)
T PRK11432         26 DLTIKQGTMVTLLGPSGCGKTTVLRLVAGLEKPTSGQIFIDG   67 (351)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             749889989999999964999999999769998836999999