HHsearch alignment for GI: 254780724 and conserved domain: PRK12723

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional.
Probab=97.12  E-value=0.0017  Score=43.03  Aligned_cols=115  Identities=14%  Similarity=0.202  Sum_probs=51.8

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHC--CCCCC---EEEE-ECCHHHCCCCCCEEEEEEECCCCCCC---CCCHHHHHHHH
Q ss_conf             8848998188888889999998303--87676---7999-64213125678756778741666653---00018999987
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTRYI--DKDER---IVTC-EDTAELQLQQPHVVRLETRPPNIEGE---GEITMRDLVKN  320 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~~i--~~~~r---ivtI-ED~~El~l~~~~~v~~~~~~~~~e~~---~~~t~~~ll~~  320 (483)
T Consensus       174 ~~vi~lVGPTGvGKTTTiAKLAa~~~l~~~~k~~~V~lit~DtyRi--gAveQLktya~il~vp~~v~~~~~dl~~~l~~  251 (388)
T PRK12723        174 KRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNYRI--GAKKQIQTYGDIMGIPVKAIESFKDLKEEITQ  251 (388)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCH--HHHHHHHHHHHHHCCCEEEECCHHHHHHHHHH
T ss_conf             6289998998875787999999999986267677379998078758--89999999999978806985788999999997


Q ss_pred             HHHCCCCEEEECCC-CC---H----HHHHHHHHHHCCCCEEEHHHCCCCHHHHHHHH
Q ss_conf             52059988996575-87---9----99999999873970102000478888899999
Q gi|254780724|r  321 CLRMRPERIILGEV-RG---P----EVLDLLQAMNTGHDGSMGTIHANNARESFGRM  369 (483)
Q Consensus       321 aLR~~PD~IiVGEi-Rg---~----Ea~~~l~A~~TGH~G~ltTlHa~s~~~ai~RL  369 (483)
T Consensus       252 --~~~~D~IlIDTAGrs~~d~~~~~el~~~~~~~~~~~~-~~Lvlsat~~~~d~~~i  305 (388)
T PRK12723        252 --SKDFDLVLIDTIGKSPKDFMKLAEMKELLNACGRDAE-FHLAVSSTTKTSDIKEI  305 (388)
T ss_pred             --HCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCE-EEEEECCCCCHHHHHHH
T ss_conf             --2499999995899885689999999999974189845-99998798999999999