HHsearch alignment for GI: 254780724 and conserved domain: PRK12724

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional.
Probab=97.20  E-value=0.00022  Score=49.30  Aligned_cols=121  Identities=16%  Similarity=0.159  Sum_probs=59.2

Q ss_pred             CCCCEEEECCCCCCHHHHHHHHHH-H-CCCCCCEEEE-ECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             588489981888888899999983-0-3876767999-642131256787567787416666530001899998752059
Q gi|254780724|r  249 IRCNVLISGGTGSGKTTLLNCLTR-Y-IDKDERIVTC-EDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR  325 (483)
Q Consensus       249 ~~~nilVsG~TGSGKTT~L~al~~-~-i~~~~rivtI-ED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~  325 (483)
T Consensus       222 ~~kvi~lVGPTGVGKTTTiAKLAA~~~l~~~kkVaLIT~DTYRI--gAvEQLktYa~Il~iPv~vv~~~~el~~al~~~~  299 (432)
T PRK12724        222 QRKVVFFVGPTGSGKTTSIAKLAAKYFLHMGKSVSLYTTDNYRI--AAIEQLKRYADTMGMPFYPVKDIKKFKETLARDG  299 (432)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCH--HHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHCC
T ss_conf             76299998999988899999999999997499279995266537--7999999999985994599518999999998569


Q ss_pred             CCEEEECCC----CCHHHH----HHHHHHHCC-CCEEEHHHCCCCHHHHHHHHHH
Q ss_conf             988996575----879999----999998739-7010200047888889999997
Q gi|254780724|r  326 PERIILGEV----RGPEVL----DLLQAMNTG-HDGSMGTIHANNARESFGRMEA  371 (483)
Q Consensus       326 PD~IiVGEi----Rg~Ea~----~~l~A~~TG-H~G~ltTlHa~s~~~ai~RL~~  371 (483)
T Consensus       300 ~DlILIDTAGrS~rd~~~~~eL~~ll~~~~~~~~ie~~LVLSaTtk~~dl~~ii~  354 (432)
T PRK12724        300 SELILIDTAGYSHRNLEQLERMQSFYSCFGEKDSVENLLVLSSTSSYHHTLTVLK  354 (432)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHH
T ss_conf             9999992999897899999999999986366788517999978899899999999