HHsearch alignment for GI: 254780724 and conserved domain: PRK13536

>PRK13536 nodulation factor exporter subunit NodI; Provisional.
Probab=96.29  E-value=0.0065  Score=38.98  Aligned_cols=116  Identities=19%  Similarity=0.179  Sum_probs=64.9

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECC------HHHC-----CCCC-CEEEEEEECCCC-----
Q ss_conf             9862258848998188888889999998303876767999642------1312-----5678-756778741666-----
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT------AELQ-----LQQP-HVVRLETRPPNI-----  306 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~------~El~-----l~~~-~~v~~~~~~~~~-----  306 (483)
T Consensus        27 s~~v~~Gei~gllGpNGAGKSTli~~l~Gl~~p~sG~i~i~G~~~~~~~~~~r~~iG~~pq~~~l~~~ltv~enl~~~~~  106 (306)
T PRK13536         27 SFTVASGECFGLLGPNGAGKSTIARMILGMTSPDAGKITVLGVPVPARARLARARIGVVPQFDNLDLEFTVRENLLVFGR  106 (306)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCHHHHHCCEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             77885996999999989809999999967957898779999873654568886268997066656757799999999999


Q ss_pred             -------------------------------CCCCCCHHHHHHHHHHHCCCCEEEECCC-C--CHHH----HHHHHH-HH
Q ss_conf             -------------------------------6530001899998752059988996575-8--7999----999999-87
Q gi|254780724|r  307 -------------------------------EGEGEITMRDLVKNCLRMRPERIILGEV-R--GPEV----LDLLQA-MN  347 (483)
Q Consensus       307 -------------------------------e~~~~~t~~~ll~~aLR~~PD~IiVGEi-R--g~Ea----~~~l~A-~~  347 (483)
T Consensus       107 ~~g~~~~~~~~~~~~ll~~~~L~~~~~~~~~~lSgG~kqrl~iA~aL~~~P~lliLDEPT~GLDp~~r~~i~~~i~~l~~  186 (306)
T PRK13536        107 YFGMSTREIEAVIPSLLEFARLESKADARVSDLSGGMKRRLTLARALINDPQLLILDEPTTGLDPHARHLIWERLRSLLA  186 (306)
T ss_pred             HCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             72999999999999999877985686673777899899999999999559989997587567899999999999999996


Q ss_pred             CCCCEEEHHHCCC
Q ss_conf             3970102000478
Q gi|254780724|r  348 TGHDGSMGTIHAN  360 (483)
Q Consensus       348 TGH~G~ltTlHa~  360 (483)
T Consensus       187 ~G~T-illttH~l  198 (306)
T PRK13536        187 RGKT-ILLTTHFM  198 (306)
T ss_pred             CCCE-EEEECCCH
T ss_conf             8989-99988838