HHsearch alignment for GI: 254780724 and conserved domain: PRK13542

>PRK13542 consensus.
Probab=97.18  E-value=0.00055  Score=46.47  Aligned_cols=42  Identities=26%  Similarity=0.241  Sum_probs=35.8

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        38 sl~i~~Gei~~liGpNGaGKTTLlk~l~Gll~p~~G~I~~~G   79 (224)
T PRK13542         38 DISLAPGDLLQVMGPNGSGKTSLLRVLSGLMPPAEGDLYWRG   79 (224)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECC
T ss_conf             678759979999999999999999999579788852899999