HHsearch alignment for GI: 254780724 and conserved domain: PRK13635

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.15  E-value=0.00059  Score=46.28  Aligned_cols=42  Identities=26%  Similarity=0.219  Sum_probs=35.1

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        27 sl~i~~GE~vaivG~nGsGKSTL~k~l~Gl~~p~~G~I~i~G   68 (279)
T PRK13635         27 SFSVYEGEWVAIVGHNGSGKSTLAKLLNGLLLPEAGTITVGG   68 (279)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECC
T ss_conf             768879989999999996599999999728888896499999