HHsearch alignment for GI: 254780724 and conserved domain: PRK13645

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.96  E-value=0.0011  Score=44.39  Aligned_cols=41  Identities=22%  Similarity=0.242  Sum_probs=32.9

Q ss_pred             HHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             86225884899818888888999999830387676799964
Q gi|254780724|r  245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       245 ~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        32 l~i~~Ge~~aIiG~nGsGKSTL~~~l~Gll~p~~G~v~~~~   72 (289)
T PRK13645         32 LTFKKNKVTCVIGTTGSGKSTMIQLTNGLIISETGQTIVGD   72 (289)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECC
T ss_conf             89889989999999995799999999659889998599999