HHsearch alignment for GI: 254780724 and conserved domain: PRK13657

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional.
Probab=97.43  E-value=0.00018  Score=49.79  Aligned_cols=43  Identities=30%  Similarity=0.435  Sum_probs=37.6

Q ss_pred             HHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             8986225884899818888888999999830387676799964
Q gi|254780724|r  243 LQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       243 l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus       354 isl~i~~Ge~vaiVG~SGsGKSTL~~LL~gly~p~~G~I~idg  396 (585)
T PRK13657        354 VSFEAKPGQTVAIVGPTGAGKSTLINLLHRVFDPQSGRIRIDG  396 (585)
T ss_pred             CEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCEEECC
T ss_conf             0389759988999889898699999998601578879675898