HHsearch alignment for GI: 254780724 and conserved domain: PRK13700

>PRK13700 conjugal transfer protein TraD; Provisional.
Probab=96.34  E-value=0.0038  Score=40.57  Aligned_cols=40  Identities=23%  Similarity=0.475  Sum_probs=29.8

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCC-CCCEEEEECCHHH
Q ss_conf             884899818888888999999830387-6767999642131
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTRYIDK-DERIVTCEDTAEL  289 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~~i~~-~~rivtIED~~El  289 (483)
T Consensus       185 ~qH~li~GTtGtGKS~~ir~LL~qIR~RGdrAIIyD~~G~F  225 (732)
T PRK13700        185 IQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEF  225 (732)
T ss_pred             HHEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             31267746888889999999999999729958999399853