HHsearch alignment for GI: 254780724 and conserved domain: PRK13721

>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional.
Probab=95.53  E-value=0.019  Score=35.68  Aligned_cols=41  Identities=24%  Similarity=0.360  Sum_probs=34.1

Q ss_pred             CCCEEEECCCCCCHHHHHHHHH-HHCCCCCCEEEEECCHHHC
Q ss_conf             8848998188888889999998-3038767679996421312
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLT-RYIDKDERIVTCEDTAELQ  290 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~-~~i~~~~rivtIED~~El~  290 (483)
T Consensus       474 N~N~~I~g~SGsGKSf~~q~l~~~~~~~G~~V~IID~G~SY~  515 (864)
T PRK13721        474 NYNMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYK  515 (864)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHH
T ss_conf             700699828998689999999999985799799996997899