HHsearch alignment for GI: 254780724 and conserved domain: PRK13833

>PRK13833 conjugal transfer protein TrbB; Provisional.
Probab=100.00  E-value=0  Score=588.91  Aligned_cols=308  Identities=33%  Similarity=0.501  Sum_probs=283.7

Q ss_pred             HHHHHHHHHHHHCCCC-CHHHHCCCCCCEEEEECCCCEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCE
Q ss_conf             9999999998856563-358858833217998569918998278389717620798999999999999809812433877
Q gi|254780724|r  111 LDLFEDLCNDILGYGP-LQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPI  189 (483)
Q Consensus       111 ~~l~~~i~~e~~glGp-L~~ll~D~~VsdI~ing~~~I~ve~~G~~~~~~~~f~~~~~l~~~i~rla~~~g~~i~~~~P~  189 (483)
T Consensus         8 ~r~~~~l~~~---lg~~i~~lL~Dp~VtEI~iN~~~~Vwver~G~~~~~-~~~~~~~~~~~~i~~iA~~~g~~id~~~Pi   83 (323)
T PRK13833          8 PRLVRKLQDA---LGDQLCVALDDATVVEIMLNPDGKLFIERLGHGVAP-AGEMSSAAAEIVIGSVAHALQSEADDERPI   83 (323)
T ss_pred             HHHHHHHHHH---HHHHHHHHHCCCCCEEEEECCCCEEEEEECCCEEEE-CCCCCHHHHHHHHHHHHHHHCCEECCCCCE
T ss_conf             2799999985---569999970799966999838995999967967874-475899999999999999859986689855


Q ss_pred             EEEEEC-CCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHH
Q ss_conf             879823-7620345315535788168884057654667888650699889999989862258848998188888889999
Q gi|254780724|r  190 CDARLL-DGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN  268 (483)
Q Consensus       190 ~d~~lp-dg~Ri~~~~~p~s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~  268 (483)
T Consensus        84 lda~LP~~G~R~~~v~PP~~-~g~sitIRk~~~~~~tl~dlv~~g~~t~~~~~~L~~aV~~r~nilVsGgTGSGKTTlln  162 (323)
T PRK13833         84 ISGELPIGGHRFEGLLPPVV-SGPAFTIRRRASRLIPLDDYVRSKVMTEAQASTIRSAISSRLNIVISGGTGSGKTTLAN  162 (323)
T ss_pred             EEEECCCCCEEEEEECCCCC-CCCEEEEECCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHH
T ss_conf             89987999989999878867-99529996878999999999876999999999999999818968999177775689999


Q ss_pred             HHHHHC---CCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             998303---87676799964213125678756778741666653000189999875205998899657587999999999
Q gi|254780724|r  269 CLTRYI---DKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQA  345 (483)
Q Consensus       269 al~~~i---~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~IiVGEiRg~Ea~~~l~A  345 (483)
T Consensus       163 aL~~~i~~~~p~eRivtIEDt~EL~~~~~n~v~l~~~-------~~v~~~~Ll~~aLRmrPDRIivGEvRG~EA~~~L~A  235 (323)
T PRK13833        163 AVIAEIVASAPEDRLVILEDTAEIQCAAENAVLLHTS-------DTVDMARLLKSTMRLRPDRIIVGEVRDGAALTLLKA  235 (323)
T ss_pred             HHHHHHCCCCCHHEEEEECCCCCCCCCCCCEEEEECC-------CCCCHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             9998640289323399945750114678877787516-------986999999997446997588830065999999999


Q ss_pred             HHCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCEEEEEEECCCCCEEEEEEEEEEEEECCEEEE
Q ss_conf             87397010200047888889999997553046799989999999742358899987699987899999998414988998
Q gi|254780724|r  346 MNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIIT  425 (483)
Q Consensus       346 ~~TGH~G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia~avd~iV~~~r~~dG~Rrv~~I~Ev~g~e~~~~~~  425 (483)
T Consensus       236 ~nTGH~Gs~tTiHAnsa~~al~RL~~l~~~~----~~~~~~~~ia~avdviV~i~r~~~g-Rrv~eI~eV~g~~~g~y~~  310 (323)
T PRK13833        236 WNTGHPGGVTTIHSNTAMSALRRLEQLTAEA----SQQPMQEVIGEAVDLIVSIERTGRG-RRVRDVIHVEGFANGRYQT  310 (323)
T ss_pred             HHCCCCCCCCCCCCCCHHHHHHHHHHHHHHC----CHHHHHHHHHHHCCEEEEEEECCCC-CEEEEEEEEECCCCCEEEE
T ss_conf             8279998634865799999999999998852----6377999999868899999876999-4899999993245998999


Q ss_pred             EEEEEEEEEC
Q ss_conf             6789875406
Q gi|254780724|r  426 QDLLKYEVMG  435 (483)
Q Consensus       426 ~~if~~~~~~  435 (483)
T Consensus       311 ~~l~~~d~~~  320 (323)
T PRK13833        311 EHYAQIDEDS  320 (323)
T ss_pred             EEEEEECCCC
T ss_conf             7723463412