HHsearch alignment for GI: 254780724 and conserved domain: PTZ00301

>PTZ00301 uridine kinase; Provisional.
Probab=96.69  E-value=0.0022  Score=42.25  Aligned_cols=37  Identities=30%  Similarity=0.299  Sum_probs=25.5

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCC---CCCEEEE-ECC
Q ss_conf             884899818888888999999830387---6767999-642
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTRYIDK---DERIVTC-EDT  286 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~~i~~---~~rivtI-ED~  286 (483)
T Consensus         3 ~~iIgIaGgSgSGKTT~a~~i~~~l~~~~~~~~v~ii~~D~   43 (210)
T PTZ00301          3 CTVIGISGASGSGKSSLSTNIVSELMAHCGPVSIGVICEDF   43 (210)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             88999968876789999999999987614998079983676