HHsearch alignment for GI: 254780724 and conserved domain: TIGR00073

>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=95.62  E-value=0.012  Score=37.00  Aligned_cols=76  Identities=26%  Similarity=0.349  Sum_probs=51.7

Q ss_pred             EEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCC-CCEEEEC
Q ss_conf             998188888889999998303876767999642131256787567787416666530001899998752059-9889965
Q gi|254780724|r  254 LISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR-PERIILG  332 (483)
Q Consensus       254 lVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~-PD~IiVG  332 (483)
T Consensus        38 NfmsspGSGKT~LiEk~~~~~~~~~K~Avi~GD~------------------------~t~~DA~R--lR~~G~~a~---   88 (225)
T TIGR00073        38 NFMSSPGSGKTTLIEKLIERLDDEVKIAVIEGDV------------------------QTKNDADR--LRKYGVPAI---   88 (225)
T ss_pred             EECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCH------------------------HHHHHHHH--HHHCCCEEE---
T ss_conf             8025886115899999999845789789997553------------------------22556999--986498688---


Q ss_pred             CCCCHHHHHHHHHHHCCCCEEEHHHCCCCHHHHHHHHHHHH
Q ss_conf             75879999999998739701020004788888999999755
Q gi|254780724|r  333 EVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMI  373 (483)
Q Consensus       333 EiRg~Ea~~~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~m~  373 (483)
T Consensus        89 ------------~~nTGk~---CHLdA~mv~G~~~~L~~~~  114 (225)
T TIGR00073        89 ------------QINTGKE---CHLDAHMVAGAIHALKDLP  114 (225)
T ss_pred             ------------EECCCCC---CCCHHHHHHHHHHHHHCCC
T ss_conf             ------------6368864---4401667865875542168