HHsearch alignment for GI: 254780724 and conserved domain: TIGR01420

>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=100.00  E-value=2.8e-45  Score=335.75  Aligned_cols=275  Identities=25%  Similarity=0.370  Sum_probs=218.1

Q ss_pred             HHHHHHHHCCCCCHHHHCCCCCCEEEEECCCCEEEEECCEEE-ECCCCCCCHHHHHHHHHHHHH---HHCCCCCCCCCEE
Q ss_conf             999998856563358858833217998569918998278389-717620798999999999999---8098124338778
Q gi|254780724|r  115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTV-ETGINFRDNEQLLSVCQRIVN---QVGRRVDESSPIC  190 (483)
Q Consensus       115 ~~i~~e~~glGpL~~ll~D~~VsdI~ing~~~I~ve~~G~~~-~~~~~f~~~~~l~~~i~rla~---~~g~~i~~~~P~~  190 (483)
T Consensus         3 ~~ll~~~~~~----------~aSD~HL~aG~PP~~R~~G~~~~~~~~~plt~~~~~~l~~~~l~~th~~~~~~f~~~~E~   72 (350)
T TIGR01420         3 EELLREAVKK----------GASDIHLSAGLPPAIRIDGDLRTRIGFEPLTPEDTQKLLREILSSTHEKQREEFEENGEL   72 (350)
T ss_pred             HHHHHHHHHC----------CCCEEEEECCCCEEEEECCCEECCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHCCCC
T ss_conf             7889999848----------997488503774037547831034467898989999999986384565777505650664


Q ss_pred             EE--EECCCCEEEEECCCCCCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHH
Q ss_conf             79--8237620345315535788168884057654667888650699889999989862258848998188888889999
Q gi|254780724|r  191 DA--RLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN  268 (483)
Q Consensus       191 d~--~lpdg~Ri~~~~~p~s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~  268 (483)
T Consensus        73 Dfs~~~~~~~RfRvN~f~-QRg~~a~vlR~ip~~Ip~fe~L---GLP~~v---~~~~a~~~~GLiLVTGPTGSGKSTTlA  145 (350)
T TIGR01420        73 DFSFSLPGLARFRVNAFK-QRGGVALVLRLIPSKIPTFEEL---GLPRPV---LRELAERPRGLILVTGPTGSGKSTTLA  145 (350)
T ss_pred             CEEEEECCCCEEEEHHHH-HCCHHHHHHHHCCCCCCCHHHC---CCCHHH---HHHHHHCCCCCEEEECCCCCCHHHHHH
T ss_conf             446630673221220323-5000642323115346216663---798789---999983669938987688986789999


Q ss_pred             HHHHHCCCC--CCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHH-HHHHH
Q ss_conf             998303876--767999642131256787567787416666530001899998752059988996575879999-99999
Q gi|254780724|r  269 CLTRYIDKD--ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVL-DLLQA  345 (483)
Q Consensus       269 al~~~i~~~--~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~IiVGEiRg~Ea~-~~l~A  345 (483)
T Consensus       146 smIDyIN~~~~~HIiTIEDPIEyvh~~~~sli--~-QREv-G~DT~sF~~ALraALReDPDvILiGE~RD~ET~~~AL~A  221 (350)
T TIGR01420       146 SMIDYINKNKAGHIITIEDPIEYVHKNKRSLI--N-QREV-GLDTLSFANALRAALREDPDVILIGEMRDLETVELALTA  221 (350)
T ss_pred             HHHHHHHCCCCCCCEEEECCEEEEECCCEEEE--E-CCCC-CCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHH
T ss_conf             99978740388882563177314104770245--4-3624-675457999976841028988998255627899999987


Q ss_pred             HHCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCEEEEEEEC--CCCCEEEEEEEEEE
Q ss_conf             873970102000478888899999975530467999899999997423588999876--99987899999998
Q gi|254780724|r  346 MNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRL--RDGSRRITNICEIV  416 (483)
Q Consensus       346 ~~TGH~G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia~avd~iV~~~r~--~dG~Rrv~~I~Ev~  416 (483)
T Consensus       222 AETGHL-V~gTLHTnsA~~ti~RIid~FP~~----~~~qiR~~La~~L~Av~sQrL~p~~~G~GRv-~~~Eil  288 (350)
T TIGR01420       222 AETGHL-VFGTLHTNSAAKTIERIIDVFPAE----EQEQIRTQLAESLVAVISQRLLPKKNGGGRV-LAVEIL  288 (350)
T ss_pred             HHHCCH-HHHHHHHHHHHHHHHHHHCCCCHH----HHHHHHHHHHHHHHHHHCCCCEEECCCCCEE-EEEEEE
T ss_conf             421315-676666423888767774259775----6689999998767877000542233896258-888752