HHsearch alignment for GI: 254780724 and conserved domain: TIGR01447

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. C-terminal part of the protein matches a domain found in viral RNA helicase, superfamily 1, IPR000606 from INTERPRO. ; GO: 0008854 exodeoxyribonuclease V activity, 0009338 exodeoxyribonuclease V complex.
Probab=96.73  E-value=0.0024  Score=41.98  Aligned_cols=129  Identities=19%  Similarity=0.221  Sum_probs=65.0

Q ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHC----CCC----CCEEEEECCHH----H---------CCCCCCEEEEE
Q ss_conf             989862258848998188888889999998303----876----76799964213----1---------25678756778
Q gi|254780724|r  242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYI----DKD----ERIVTCEDTAE----L---------QLQQPHVVRLE  300 (483)
Q Consensus       242 ~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i----~~~----~rivtIED~~E----l---------~l~~~~~v~~~  300 (483)
T Consensus       234 ~a~~~aL~~~f~li~GGPGTGKTTTv~~LL~al~~~~~~~G~~~~~I~l~APTGKAa~RL~esl~~~~~~L~~~~~aid~  313 (753)
T TIGR01447       234 VAVALALKSNFSLITGGPGTGKTTTVARLLLALIKQSPKQGKPRLRIALAAPTGKAAARLAESLRKAVKKLAAENMAIDE  313 (753)
T ss_pred             HHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             99999860876899879889778999999999999898649974047886684479999999999886322342366587


Q ss_pred             EECCCCCCCCCCHHHHHHHHHH---------HC---CCCEEEECCC--CCHHHH-HHHHHHHCCCC-EE-----------
Q ss_conf             7416666530001899998752---------05---9988996575--879999-99999873970-10-----------
Q gi|254780724|r  301 TRPPNIEGEGEITMRDLVKNCL---------RM---RPERIILGEV--RGPEVL-DLLQAMNTGHD-GS-----------  353 (483)
Q Consensus       301 ~~~~~~e~~~~~t~~~ll~~aL---------R~---~PD~IiVGEi--Rg~Ea~-~~l~A~~TGH~-G~-----------  353 (483)
T Consensus       314 ~~~~~~-~~~~~TiHrLLG~~~I~~~~fr~h~~N~L~~DVLvvDEaSMVdl~lm~kL~~A~~~~~k~~KLy~~~LIllGD  392 (753)
T TIGR01447       314 DLIAAL-PSEATTIHRLLGIKPIDTKRFRHHERNPLPLDVLVVDEASMVDLPLMAKLLKALPPNTKDKKLYADRLILLGD  392 (753)
T ss_pred             HHHCCC-CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCHHCCHHHHHHHHHHCCCCCCCCCHHHCCCCEECC
T ss_conf             985487-2045688886166147876776777788985527870600226799999997226300132010102001226


Q ss_pred             ---EHHHCCCCHHHHHHHHHH
Q ss_conf             ---200047888889999997
Q gi|254780724|r  354 ---MGTIHANNARESFGRMEA  371 (483)
Q Consensus       354 ---ltTlHa~s~~~ai~RL~~  371 (483)
T Consensus       393 ~nQL~sveaG~Vl~~l~~~~~  413 (753)
T TIGR01447       393 KNQLPSVEAGAVLGDLCELAN  413 (753)
T ss_pred             CCCCCCCCHHHHHHHHHHHHH
T ss_conf             788887543555799999975