>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.

Probab=95.17 E-value=0.035 Score=33.87 Aligned_cols=53 Identities=19% Similarity=0.357 Sum_probs=0.0 Q ss_pred EECCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCC---CEEEECCCCCCHHHHHHHHHHHCC Q ss_conf 40576546678886506998899999898622588---489981888888899999983038 Q gi|254780724|r 217 RKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRC---NVLISGGTGSGKTTLLNCLTRYID 275 (483) Q Consensus 217 Rk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~~~~---nilVsG~TGSGKTT~L~al~~~i~ 275 (483) T Consensus 6 RKyRP~~F~--d~~G----Q~~iv~tL~NAi~~~ri~HAYLF~GpRGtGKTS~ARIfAKaLN 61 (363) T TIGR02397 6 RKYRPQTFE--DVIG----QEHIVKTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALN 61 (363) T ss_pred ECCCCCCCC--CCCC----CHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHC T ss_conf 223788611--0235----1799999999997189662345028599763558999999865

HHsearch alignment for GI: 254780724 and conserved domain: TIGR02397