HHsearch alignment for GI: 254780724 and conserved domain: TIGR02524

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB; InterPro: IPR013363 Proteins in this entry are the DotB component of Dot/Icm secretion systems, as found in the obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the literature now seems to favor calling this the Dot/Icm system. This family is most closely related to the TraJ proteins of plasmid transfer (IPR013364 from INTERPRO), rather than to proteins of other type IV secretion systems..
Probab=99.90  E-value=5.1e-23  Score=179.44  Aligned_cols=254  Identities=24%  Similarity=0.345  Sum_probs=194.9

Q ss_pred             CCCCEEEEECCCCEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHC-------CCCC---CCCCEEEEEECCCCEEEEE
Q ss_conf             33217998569918998278389717620798999999999999809-------8124---3387787982376203453
Q gi|254780724|r  134 DDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG-------RRVD---ESSPICDARLLDGSRVNVI  203 (483)
Q Consensus       134 ~~VsdI~ing~~~I~ve~~G~~~~~~~~f~~~~~l~~~i~rla~~~g-------~~i~---~~~P~~d~~lpdg~Ri~~~  203 (483)
T Consensus        16 l~asditiqtG~~~~aevyGrl~~~t~r~lsn~e~~dl~n~iyGPn~ttq~~~G~didthye~rPnr~~r~--ryr~n~t   93 (358)
T TIGR02524        16 LNASDITIQTGRAVLAEVYGRLLKLTRRRLSNAELSDLLNAIYGPNATTQLLRGKDIDTHYEIRPNRNVRY--RYRVNAT   93 (358)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCEE--EEEEECE
T ss_conf             17430242245157789878999876444312247778875218752112320452221000046777504--6787040


Q ss_pred             CCCC-CCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHC----CCCC
Q ss_conf             1553-5788168884057654667888650699889999989862258848998188888889999998303----8767
Q gi|254780724|r  204 IPPL-ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYI----DKDE  278 (483)
Q Consensus       204 ~~p~-s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i----~~~~  278 (483)
T Consensus        94 ~C~v~Gh~~iqit~r~iP~~PP~ls~~~l----P---~~i~~aiaPqeG~v~~tGatGsGkstlla~iirel~e~~ds~r  166 (358)
T TIGR02524        94 ACLVEGHEAIQITLRAIPAEPPKLSKLDL----P---DAIVEAIAPQEGVVYVTGATGSGKSTLLAAIIRELIEASDSNR  166 (358)
T ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCC----H---HHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             44520555047787642798874431134----1---7999851788866998626776368899999999860676564


Q ss_pred             CEEEEECCHHHCCCCC