HHsearch alignment for GI: 254780724 and conserved domain: TIGR02533

>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=100.00  E-value=0  Score=410.11  Aligned_cols=263  Identities=24%  Similarity=0.279  Sum_probs=215.6

Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCEEEEECCCC---EEEEECCEEEECCCCCCCHHHHHHHHHHH
Q ss_conf             741877896789999999999885656335885883321799856991---89982783897176207989999999999
Q gi|254780724|r   99 SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK---VFIEVNGKTVETGINFRDNEQLLSVCQRI  175 (483)
Q Consensus        99 ~~~~~~~~~~~~~~l~~~i~~e~~glGpL~~ll~D~~VsdI~ing~~~---I~ve~~G~~~~~~~~f~~~~~l~~~i~rl  175 (483)
T Consensus       100 ~~L~~~~DdAPvIrlvN~~L~~Av~e----------~ASDIHIEPfE~~L~VRfRvDGvL~~V~~Pp--k~l~~alvSRv  167 (495)
T TIGR02533       100 EDLLDLEDDAPVIRLVNSLLSRAVKE----------RASDIHIEPFEKELVVRFRVDGVLRDVLSPP--KKLQAALVSRV  167 (495)
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHHH----------CCCCCCCCCCCCCCEEEEECCCEEECCCCCC--HHHHCCCCCEE
T ss_conf             73137798784899999999999974----------4885453651216353663061662343787--67742430035


Q ss_pred             HHHHCCCCCCCCCEEEEEECCCCEEEEECCC----------CCCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHH
Q ss_conf             9980981243387787982376203453155----------357881688840576546678886506998899999898
Q gi|254780724|r  176 VNQVGRRVDESSPICDARLLDGSRVNVIIPP----------LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQI  245 (483)
Q Consensus       176 a~~~g~~i~~~~P~~d~~lpdg~Ri~~~~~p----------~s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~  245 (483)
T Consensus       168 ------KiMA~LnIAEKRLPQDGRI~Lrv~Gr~~DiRVSt~Pt~fGERvVMRLLDK~~-~~l~L~~LGm~~~~l~~~~~l  240 (495)
T TIGR02533       168 ------KIMAKLNIAEKRLPQDGRISLRVAGRDIDIRVSTVPTSFGERVVMRLLDKDA-VRLDLEALGMSPELLSSLERL  240 (495)
T ss_pred             ------EECCCCCHHHCCCCCCCCEEEEECCEEEEEEEEECCCCCCCEEEHHHHCHHH-HHHHHHHCCCCHHHHHHHHHH
T ss_conf             ------6606777232178998726666737446678853058997100000112047-777588648888899999999


Q ss_pred             HHCCCCCEEEECCCCCCHHHHHHH-HHHHCCCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             622588489981888888899999-9830387676799964213125678756778741666653000189999875205
Q gi|254780724|r  246 IGRIRCNVLISGGTGSGKTTLLNC-LTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM  324 (483)
Q Consensus       246 ~v~~~~nilVsG~TGSGKTT~L~a-l~~~i~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~  324 (483)
T Consensus       241 i~rpHGIiLVTGPTGSGKtTTLYaaL~~LN~~~~NIlTvEDPVEY~i~GIgQ~Q-------vn~kIglTFA~GLRaILRQ  313 (495)
T TIGR02533       241 IKRPHGIILVTGPTGSGKTTTLYAALSRLNTPERNILTVEDPVEYQIEGIGQIQ-------VNPKIGLTFAAGLRAILRQ  313 (495)
T ss_pred             HHCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCEEEEECCCCEEE-------ECCCCCHHHHHHHHHHHCC
T ss_conf             718896188417789852588999998635899715686578247624876365-------1465430388887886427


Q ss_pred             CCCEEEECCCCCHHHH-HHHHHHHCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCEEEE
Q ss_conf             9988996575879999-9999987397010200047888889999997553046799989999999742358899
Q gi|254780724|r  325 RPERIILGEVRGPEVL-DLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQ  398 (483)
Q Consensus       325 ~PD~IiVGEiRg~Ea~-~~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia~avd~iV~  398 (483)
T Consensus       314 DPDiiMvGEIRD~ETA~IAiQASLTGHL-VLSTLHTNDAAgAvtRL~DMGvE------P----FL~aSsl~GVLA  377 (495)
T TIGR02533       314 DPDIIMVGEIRDLETAQIAIQASLTGHL-VLSTLHTNDAAGAVTRLIDMGVE------P----FLLASSLLGVLA  377 (495)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCCC------H----HHHHHHHHHHHH
T ss_conf             9988998231606899999987643257-65565540154466555325864------0----489999999998