HHsearch alignment for GI: 254780724 and conserved domain: TIGR02538

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374 This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly, and is closely related to GspE (IPR013369 from INTERPRO) of type II secretion systems (also referred to as the main terminal branch of the general secretion pathway). Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0009297 pilus biogenesis.
Probab=100.00  E-value=0  Score=415.20  Aligned_cols=260  Identities=24%  Similarity=0.319  Sum_probs=222.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCEEEEECCC---CEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             678999999999988565633588588332179985699---18998278389717620798999999999999809812
Q gi|254780724|r  107 LDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSN---KVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRV  183 (483)
Q Consensus       107 ~~~~~~l~~~i~~e~~glGpL~~ll~D~~VsdI~ing~~---~I~ve~~G~~~~~~~~f~~~~~l~~~i~rla~~~g~~i  183 (483)
T Consensus       188 DAPvvKFvN~iL~DAir~G----------ASDIHFEPYE~~yRvRyR~DG~L~Eva~PP~--~l~~ri~aRiKvMS~LDI  255 (577)
T TIGR02538       188 DAPVVKFVNKILLDAIRKG----------ASDIHFEPYEKKYRVRYRIDGVLHEVAQPPL--KLANRIAARIKVMSRLDI  255 (577)
T ss_pred             CCCCHHHHHHHHHHHHHCC----------CCCCCCCCCCCCCEEEEEECCEEHHHHCCCH--HHHHHHHHHHHHHHCCCC
T ss_conf             8870133878799998468----------8612113676872067511673164325858--899999989999732671


Q ss_pred             CCCCCEEEEEECC--------CCEEEEECCCCCCCCCEEEEEECCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             4338778798237--------62034531553578816888405765466788865069988999998986225884899
Q gi|254780724|r  184 DESSPICDARLLD--------GSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLI  255 (483)
Q Consensus       184 ~~~~P~~d~~lpd--------g~Ri~~~~~p~s~~G~~i~IRk~~~~~~~l~~l~~~g~~~~~~~~~l~~~v~~~~nilV  255 (483)
T Consensus       256 aEkR~PQDGRiKl~~sk~k~iDFRVStL---PTLfGEKvVLRiLDsS~a~L-di~~LGFeP~Qk~~fL~Ai~kPqGMvLV  331 (577)
T TIGR02538       256 AEKRIPQDGRIKLKLSKSKAIDFRVSTL---PTLFGEKVVLRILDSSAAKL-DIDKLGFEPDQKALFLEAIHKPQGMVLV  331 (577)
T ss_pred             CCCCCCCCCCEEEEECCCEEEEEEECCC---CCCCCCEEEEEEECHHHCCC-CCHHHCCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             2245687873677537844551253787---42024446677655221226-7422068888999999997079972886


Q ss_pred             ECCCCCCHHHHHHHHHHH-CCCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             818888888999999830-3876767999642131256787567787416666530001899998752059988996575
Q gi|254780724|r  256 SGGTGSGKTTLLNCLTRY-IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEV  334 (483)
Q Consensus       256 sG~TGSGKTT~L~al~~~-i~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~IiVGEi  334 (483)
T Consensus       332 TGPTGSGKTVSLYTaLniLN~~~~NISTAEDPVEINLpGINQVn-------vNpK~GLTFAaALrSFLRQDPDIIMVGEI  404 (577)
T TIGR02538       332 TGPTGSGKTVSLYTALNILNTEEVNISTAEDPVEINLPGINQVN-------VNPKIGLTFAAALRSFLRQDPDIIMVGEI  404 (577)
T ss_pred             ECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCCEEC-------CCCCCCCCHHHHHHHHCCCCCCEEEEECC
T ss_conf             26659841687876311257767450114477246407715120-------46678878799998640689988987066


Q ss_pred             CCHHHHH-HHHHHHCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCEEEEEE
Q ss_conf             8799999-99998739701020004788888999999755304679998999999974235889998
Q gi|254780724|r  335 RGPEVLD-LLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQ  400 (483)
Q Consensus       335 Rg~Ea~~-~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~~~~~~~ia~avd~iV~~~  400 (483)
T