HHsearch alignment for GI: 254780724 and conserved domain: TIGR02639

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=95.89  E-value=0.0057  Score=39.37  Aligned_cols=246  Identities=22%  Similarity=0.317  Sum_probs=144.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHCCC-----------CCHHHHCCCCCCEEEEECCC-----
Q ss_conf             899999999999999974187-7896789999999999885656-----------33588588332179985699-----
Q gi|254780724|r   83 SQSARDEIATLMNEIVSVKKI-TMSLDEQLDLFEDLCNDILGYG-----------PLQPLIARDDIADIMVNGSN-----  145 (483)
Q Consensus        83 ~~~~~~~i~~~i~~~~~~~~~-~~~~~~~~~l~~~i~~e~~glG-----------pL~~ll~D~~VsdI~ing~~-----  145 (483)
T Consensus       283 RGDFE~RLK~V~~Ei~~~~~anILFIDEIHTIV--------GAGATSGGsmDASNLLKPaL~~G---~iRCIGsTTy~EY  351 (774)
T TIGR02639       283 RGDFEERLKAVVSEIEKEPNANILFIDEIHTIV--------GAGATSGGSMDASNLLKPALASG---KIRCIGSTTYEEY  351 (774)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEEEECCCCEE--------ECCCCCCHHHHHHHHHHHHHHCC---CEEEECCCCHHHH
T ss_conf             424789999999998528999546641101033--------17878751552443211253078---7786226524864


Q ss_pred             CEEEEEC----CEEEECCCCCCCHHHHHHHHHHHHHHHCC--CCCCC------------CCEEEEEECCC---------C
Q ss_conf             1899827----83897176207989999999999998098--12433------------87787982376---------2
Q gi|254780724|r  146 KVFIEVN----GKTVETGINFRDNEQLLSVCQRIVNQVGR--RVDES------------SPICDARLLDG---------S  198 (483)
Q Consensus       146 ~I~ve~~----G~~~~~~~~f~~~~~l~~~i~rla~~~g~--~i~~~------------~P~~d~~lpdg---------~  198 (483)
T Consensus       352 ~~~FeKDrALsRRFQKIDv~EPs~eet~~ILkGLk~~YE~fH~V~Y~~eal~~Av~LS~ryI~DRfLPDKAIDviDEaGA  431 (774)
T TIGR02639       352 KNHFEKDRALSRRFQKIDVGEPSIEETVKILKGLKEQYEEFHHVKYSDEALEAAVELSARYINDRFLPDKAIDVIDEAGA  431 (774)
T ss_pred             HCHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             11101020216542331179578889999998655420132501138699999999988860257898543228899999


Q ss_pred             --EEEE------E-----------CCCCCCC---CCEEEEEECCCCCCCHHH-HHHCCCCCHHH-----------HHHHH
Q ss_conf             --0345------3-----------1553578---816888405765466788-86506998899-----------99989
Q gi|254780724|r  199 --RVNV------I-----------IPPLALD---GPTLTIRKFKKDKLTLDH-LVSFGAVTAEG-----------ARLLQ  244 (483)
Q Consensus       199 --Ri~~------~-----------~~p~s~~---G~~i~IRk~~~~~~~l~~-l~~~g~~~~~~-----------~~~l~  244 (483)
T Consensus       432 ~~~l~~~~~~~~~eadekGleetalPev~~~diE~vvak~a~iP~~~~s~ddD~~~L~~L~~~L~~kIfGQD~AI~~lv~  511 (774)
T TIGR02639       432 AFRLRAKAKKKANEADEKGLEETALPEVNVKDIEEVVAKMAKIPVKTVSSDDDREKLKNLEKELKAKIFGQDEAIEQLVS  511 (774)
T ss_pred             HHHHHHHCCCCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99971202776432011253000478785444999998871899415426447988720447630131515899999999


Q ss_pred             HH----------HCCCCCEEEECCCCCCHHHHHHHHHHHCCCC-CCEEEEECCHHHCCCCCCEEE-EEEECC-CCCCCCC
Q ss_conf             86----------2258848998188888889999998303876-767999642131256787567-787416-6665300
Q gi|254780724|r  245 II----------GRIRCNVLISGGTGSGKTTLLNCLTRYIDKD-ERIVTCEDTAELQLQQPHVVR-LETRPP-NIEGEGE  311 (483)
Q Consensus       245 ~~----------v~~~~nilVsG~TGSGKTT~L~al~~~i~~~-~rivtIED~~El~l~~~~~v~-~~~~~~-~~e~~~~  311 (483)
T Consensus       512 aiK~SrAGl~~~nkP~GSFLF~GPTGVGKTElak~LA~~LGv~l~RF----DMSEYmEKH--TVsRLIGsPPGYV----G  581 (774)
T TIGR02639       512 AIKRSRAGLGEPNKPVGSFLFVGPTGVGKTELAKQLAEELGVHLLRF----DMSEYMEKH--TVSRLIGSPPGYV----G  581 (774)
T ss_pred             HHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCHHCCC----CCHHHHHHH--HHHHHHCCCCCCC----C
T ss_conf             99998742477888168888647989625788999999708200104----650446899--9987416888851----3


Q ss_pred             CHHHHHHHHHHHCCCCE-EEECCCC--CHHHH-HHHHHHHCC
Q ss_conf             01899998752059988-9965758--79999-999998739
Q gi|254780724|r  312 ITMRDLVKNCLRMRPER-IILGEVR--GPEVL-DLLQAMNTG  349 (483)
Q Consensus       312 ~t~~~ll~~aLR~~PD~-IiVGEiR--g~Ea~-~~l~A~~TG  349 (483)
T Consensus       582 fEqGGLLT~AvrK~P~cVLLLDEIEKAHpDI~NILLQVMD~A  623 (774)
T TIGR02639       582 FEQGGLLTDAVRKHPHCVLLLDEIEKAHPDIYNILLQVMDYA  623 (774)
T ss_pred             CCCCCCCHHHHCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             167772122331288535423466663133666787663354