HHsearch alignment for GI: 254780724 and conserved domain: TIGR02759

>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128 The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM) , .; GO: 0000746 conjugation.
Probab=95.48  E-value=0.015  Score=36.45  Aligned_cols=40  Identities=33%  Similarity=0.551  Sum_probs=28.5

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCC-CCCEEEEECCHHH
Q ss_conf             884899818888888999999830387-6767999642131
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTRYIDK-DERIVTCEDTAEL  289 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~~i~~-~~rivtIED~~El  289 (483)
T Consensus       208 ~Qh~L~~GTtG~GKs~~lr~LL~~iR~rGd~AIiYDkgC~f  248 (613)
T TIGR02759       208 VQHILIHGTTGSGKSVALRKLLRWIRQRGDRAIIYDKGCTF  248 (613)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             22526645417438999999999998639858998257420