HHsearch alignment for GI: 254780724 and conserved domain: TIGR03015

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.53  E-value=0.00023  Score=49.12  Aligned_cols=132  Identities=17%  Similarity=0.229  Sum_probs=64.3

Q ss_pred             HHHCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCC-CEEEEECCH----HHCCCCCCEEEEEEEC
Q ss_conf             86506998899999898622588489981888888899999983038767-679996421----3125678756778741
Q gi|254780724|r  229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDE-RIVTCEDTA----ELQLQQPHVVRLETRP  303 (483)
Q Consensus       229 l~~~g~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~-rivtIED~~----El~l~~~~~v~~~~~~  303 (483)
T Consensus        22 ~y~s~~h~~al~~L~~~l~~~~g~~lltGe~GtGKTtllr~l~~~l~~~~~~~~~i~~~~l~~~~ll-~~i-~~~lg~~~   99 (269)
T TIGR03015        22 FYPSKGHKRAMAYLEYGLSQREGFILITGEVGAGKTTLIRNLLKRLDQERVVAAKLVNTRVDAEDLL-RMV-AADFGLET   99 (269)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH-HHH-HHHCCCCC
T ss_conf             1478669999999999996489659997299898899999999845934548999769999999999-999-99859898


Q ss_pred             CCCCCCCC--CHHHHH-HHHHHHCCCCEEEECCCC--CHHHHHHH---HHHHCCCCEEEHHHCCCCHH
Q ss_conf             66665300--018999-987520599889965758--79999999---99873970102000478888
Q gi|254780724|r  304 PNIEGEGE--ITMRDL-VKNCLRMRPERIILGEVR--GPEVLDLL---QAMNTGHDGSMGTIHANNAR  363 (483)
Q Consensus       304 ~~~e~~~~--~t~~~l-l~~aLR~~PD~IiVGEiR--g~Ea~~~l---~A~~TGH~G~ltTlHa~s~~  363 (483)
T Consensus       100 ~-~~~~~~~~~~l~~~L~~~~~~g~~~vliIDEAq~L~~~~Le~Lr~L~n~e~~~~~ll~iiL~Gqpe  166 (269)
T TIGR03015       100 E-GRDKAALLRELEDFLIEQFAAGKRALLVVDEAQNLTPELLEELRMLSNFQTDNAKLLQIFLVGQPE  166 (269)
T ss_pred             C-CCCHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCHHHHHHHHHHHCCCCCCCCCEEEEEECCHH
T ss_conf             8-989999999999999999966994699972422199999999999970135888704899957867