HHsearch alignment for GI: 254780724 and conserved domain: TIGR03499

>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=96.83  E-value=0.00052  Score=46.63  Aligned_cols=39  Identities=28%  Similarity=0.333  Sum_probs=26.0

Q ss_pred             CCCCEEEECCCCCCHHHHHHHHHHH-C--CCCCCEEEE-ECCH
Q ss_conf             5884899818888888999999830-3--876767999-6421
Q gi|254780724|r  249 IRCNVLISGGTGSGKTTLLNCLTRY-I--DKDERIVTC-EDTA  287 (483)
Q Consensus       249 ~~~nilVsG~TGSGKTT~L~al~~~-i--~~~~rivtI-ED~~  287 (483)
T Consensus       193 ~~~vi~lvGPTGVGKTTTiAKLAa~~~l~~~~~~V~lIT~Dty  235 (282)
T TIGR03499       193 QGGVIALVGPTGVGKTTTLAKLAARFVLEHGKKKVALITTDTY  235 (282)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             6727999778887578899999999999738996799980777