HHsearch alignment for GI: 254780724 and conserved domain: TIGR03574

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=95.93  E-value=0.057  Score=32.39  Aligned_cols=122  Identities=15%  Similarity=0.239  Sum_probs=67.3

Q ss_pred             CEEEECCCCCCHHHHHHHHHHHCC-CCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEE
Q ss_conf             489981888888899999983038-7676799964213125678756778741666653000189999875205998899
Q gi|254780724|r  252 NVLISGGTGSGKTTLLNCLTRYID-KDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII  330 (483)
Q Consensus       252 nilVsG~TGSGKTT~L~al~~~i~-~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~Ii  330 (483)
T Consensus         1 Livl~GlP~SGKSt~a~~L~~~l~~~~~~~i~~~~d~-~~~~~~~~------~~~~Ek~~r~~~~~~v~~~l~~-~~~vI   72 (249)
T TIGR03574         1 LIILTGLPGVGKSTFSKELSKKLSEKNIDNIILGTDL-IRESFPVW------KEKYEEFIRDSTLYLIKTALKN-KYSVI   72 (249)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHC------CHHHHHHHHHHHHHHHHHHHCC-CCEEE
T ss_conf             9789678999899999999999998299659965520-02120003------3677999899999999998433-76699


Q ss_pred             ECCC---CCH--HHHHHHHHHHCCCCEEEHHHCCCCHHHHH-HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             6575---879--99999999873970102000478888899-99997553046799989999999
Q gi|254780724|r  331 LGEV---RGP--EVLDLLQAMNTGHDGSMGTIHANNARESF-GRMEAMIAMGGFTLPSQMVREII  389 (483)
Q Consensus       331 VGEi---Rg~--Ea~~~l~A~~TGH~G~ltTlHa~s~~~ai-~RL~~m~~~~~~~~~~~~~~~~i  389 (483)
T Consensus        73 ~D~~nYiKg~RYEL~clAk~~~t~~----c~I~~~~p~e~c~~~N~~----R~~~~~~e~i~~m~  129 (249)
T TIGR03574        73 VDDTNYYNSKRRDLINIAKEYNKNY----IIIYLKAPLDTLLRRNIE----RGEKIPNEVIKDMY  129 (249)
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCCE----EEEEECCCHHHHHHHHHH----CCCCCCHHHHHHHH
T ss_conf             7273278899999999999849986----999973999999998760----68999999999999