HHsearch alignment for GI: 254780724 and conserved domain: cd01121

>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=97.39  E-value=0.0055  Score=39.46  Aligned_cols=156  Identities=17%  Similarity=0.277  Sum_probs=87.8

Q ss_pred             CCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCC-CCCEEEE--ECCHHH--------CCCCCCEEEEEEE
Q ss_conf             9988999998986225884899818888888999999830387-6767999--642131--------2567875677874
Q gi|254780724|r  234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK-DERIVTC--EDTAEL--------QLQQPHVVRLETR  302 (483)
Q Consensus       234 ~~~~~~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~-~~rivtI--ED~~El--------~l~~~~~v~~~~~  302 (483)
T Consensus        66 Tgi~ElDRVLGGGiVpGSvvLlgGePGIGKSTLLLQia~~la~~~~~vLYvSGEES~~QIk~RA~RLg~~~~~l~-----  140 (372)
T cd01121          66 TGIEELDRVLGGGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRGGKVLYVSGEESPEQIKLRADRLGISTENLY-----  140 (372)
T ss_pred             CCCHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHHHHHHCCCCCCCE-----
T ss_conf             783666540057730671799825998868899999999998639938998245678999989998587887727-----


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHCCCCEEEHHHCCCCHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             16666530001899998752059988996575879999999998739701020004788888999999755304679998
Q gi|254780724|r  303 PPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPS  382 (483)
Q Consensus       303 ~~~~e~~~~~t~~~ll~~aLR~~PD~IiVGEiRg~Ea~~~l~A~~TGH~G~ltTlHa~s~~~ai~RL~~m~~~~~~~~~~  382 (483)
T Consensus       141 -----l~set~le~Il~~i~~~kP~~lIIDSIQ-----T~~~~~~~s~pGsvsQVR-----eca~~L~~~AK~~~--i--  201 (372)
T cd01121         141 -----LLAETNLEDILASIEELKPDLVIIDSIQ-----TVYSSELTSAPGSVSQVR-----ECTAELMRFAKERN--I--  201 (372)
T ss_pred             -----EEECCCHHHHHHHHHHHCCCEEEEECHH-----HCCCCCCCCCCCCHHHHH-----HHHHHHHHHHHHCC--C--
T ss_conf             -----8843569999999997199889995622-----020377677998789999-----99999999998619--7--


Q ss_pred             HHHHHHHHHHCCEEEEEEECCC--CCEEEEEEEEEEE-EECCE
Q ss_conf             9999999742358899987699--9878999999984-14988
Q gi|254780724|r  383 QMVREIITSSLDVIVQTQRLRD--GSRRITNICEIVG-MEGNV  422 (483)
Q Consensus       383 ~~~~~~ia~avd~iV~~~r~~d--G~Rrv~~I~Ev~g-~e~~~  422 (483)
T Consensus       202 ---------~~~lVGHVTK~G~iAGPkvLEHmVDtVl~fEgd~  235 (372)
T cd01121         202 ---------PIFIVGHVTKEGSIAGPKVLEHMVDTVLYFEGDR  235 (372)
T ss_pred             ---------EEEEEEEECCCCCCCCCHHHEEEEEEEEEECCCC
T ss_conf             ---------3999987626886377403100213688751577