HHsearch alignment for GI: 254780724 and conserved domain: cd01394

>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=97.13  E-value=0.0089  Score=38.03  Aligned_cols=46  Identities=17%  Similarity=0.112  Sum_probs=32.5

Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHH-HCCCCCCEEEEE
Q ss_conf             9999898622588489981888888899999983-038767679996
Q gi|254780724|r  239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTR-YIDKDERIVTCE  284 (483)
Q Consensus       239 ~~~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~-~i~~~~rivtIE  284 (483)
T Consensus         8 lD~vLgGGi~~G~it~i~G~pG~GKStl~lq~a~~~~~~g~~v~Yid   54 (218)
T cd01394           8 LDELLGGGVERGTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYID   54 (218)
T ss_pred             HHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99985699878879999899998499999999999863698699996