HHsearch alignment for GI: 254780724 and conserved domain: cd03213

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=97.42  E-value=0.0013  Score=43.77  Aligned_cols=113  Identities=20%  Similarity=0.225  Sum_probs=59.0

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCC--CCCEEEEECCH--HHCCCCCCEEEEEEECCCCCC-----------
Q ss_conf             986225884899818888888999999830387--67679996421--312567875677874166665-----------
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK--DERIVTCEDTA--ELQLQQPHVVRLETRPPNIEG-----------  308 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~--~~rivtIED~~--El~l~~~~~v~~~~~~~~~e~-----------  308 (483)
T Consensus        29 s~~v~~Gei~~ilGpnGaGKSTLl~~l~Gl~~~~~~~G~i~~~g~~~~~~~~~--~~ig~v~Q~~~l~~~ltv~e~l~~~  106 (194)
T cd03213          29 SGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLGVSGEVLINGRPLDKRSFR--KIIGYVPQDDILHPTLTVRETLMFA  106 (194)
T ss_pred             EEEEECCEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEEECCEECCHHHHH--HEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             88990881999998999519999999857777899628999999999757843--1289984665237768499999999


Q ss_pred             ------CCCCHHHHHHHHHHHCCCCEEEECCC-C--CHHH----HHHHHH-HHCCCCEEEHHHCC
Q ss_conf             ------30001899998752059988996575-8--7999----999999-87397010200047
Q gi|254780724|r  309 ------EGEITMRDLVKNCLRMRPERIILGEV-R--GPEV----LDLLQA-MNTGHDGSMGTIHA  359 (483)
Q Consensus       309 ------~~~~t~~~ll~~aLR~~PD~IiVGEi-R--g~Ea----~~~l~A-~~TGH~G~ltTlHa  359 (483)
T Consensus       107 a~l~~LSgGqrqRv~iA~aL~~~P~illlDEPTsgLD~~~~~~i~~~l~~l~~~g~t-vi~~tH~  170 (194)
T cd03213         107 AKLRGLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSSSALQVMSLLRRLADTGRT-IICSIHQ  170 (194)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCE-EEEEECC
T ss_conf             872698889999999999996399889994898788989999999999999968989-9999588