HHsearch alignment for GI: 254780724 and conserved domain: cd03228

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.65  E-value=0.00015  Score=50.36  Aligned_cols=113  Identities=27%  Similarity=0.331  Sum_probs=63.5

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECC--HHHC----------CCCCCEEEEEEECCCCCCCCC
Q ss_conf             9862258848998188888889999998303876767999642--1312----------567875677874166665300
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT--AELQ----------LQQPHVVRLETRPPNIEGEGE  311 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~--~El~----------l~~~~~v~~~~~~~~~e~~~~  311 (483)
T Consensus        22 sl~i~~Ge~i~ivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~~~~~i~~v~Q~~~lf~~tv~eNiL-SgG  100 (171)
T cd03228          22 SLTIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILIDGVDLRDLDLESLRKNIAYVPQDPFLFSGTIRENIL-SGG  100 (171)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHEEEECCCCCCCCCCHHHHCC-CHH
T ss_conf             8998599899999999983999999997677589748999999988599899863189996668437577999774-488


Q ss_pred             CHHHHHHHHHHHCCCCEEEECCCC---CHHHH----HHHHHHHCCCCEEEHHHC
Q ss_conf             018999987520599889965758---79999----999998739701020004
Q gi|254780724|r  312 ITMRDLVKNCLRMRPERIILGEVR---GPEVL----DLLQAMNTGHDGSMGTIH  358 (483)
Q Consensus       312 ~t~~~ll~~aLR~~PD~IiVGEiR---g~Ea~----~~l~A~~TGH~G~ltTlH  358 (483)
T Consensus       101 q~Qri~lARal~~~p~illlDEpts~LD~~~~~~i~~~l~~~~~~~T-vi~vtH  153 (171)
T cd03228         101 QRQRIAIARALLRDPPILILDEATSALDPETEALILEALRALAKGKT-VIVIAH  153 (171)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCE-EEEEEC
T ss_conf             99999999999748998999577667998999999999999809998-999957