HHsearch alignment for GI: 254780724 and conserved domain: cd03249

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=97.46  E-value=0.00017  Score=50.05  Aligned_cols=42  Identities=21%  Similarity=0.349  Sum_probs=36.3

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             986225884899818888888999999830387676799964
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED  285 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED  285 (483)
T Consensus        23 sl~i~~G~~iaIvG~sGsGKSTLl~ll~gl~~p~~G~I~idg   64 (238)
T cd03249          23 SLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEILLDG   64 (238)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECC
T ss_conf             899769999999999999899999998238618851899999