HHsearch alignment for GI: 254780724 and conserved domain: cd03260

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=96.59  E-value=0.0029  Score=41.40  Aligned_cols=79  Identities=27%  Similarity=0.258  Sum_probs=45.1

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCC-----CCCCEEEEECCH--HHCCC---CCCEEEEEEECCCCCCCCCCH
Q ss_conf             98622588489981888888899999983038-----767679996421--31256---787567787416666530001
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYID-----KDERIVTCEDTA--ELQLQ---QPHVVRLETRPPNIEGEGEIT  313 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~-----~~~rivtIED~~--El~l~---~~~~v~~~~~~~~~e~~~~~t  313 (483)
T Consensus        20 sl~i~~Ge~~~iiG~SGsGKSTll~~i~gL~~~~~~~p~~G~I~~~g~~i~~~~~~~~~~R~~ig~VfQ~~~lf---~~T   96 (227)
T cd03260          20 SLDIPKGEITALIGPSGCGKSTLLRLLNRLNDLIPGAPDEGEVLLDGKDIYDLDVDVLELRRRVGMVFQKPNPF---PGS   96 (227)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEECCEECCCCCCCHHHHHHCCEEECCCCCCC---CCC
T ss_conf             67887998999999999819999999974450268998146999999999889958788962826876477667---780


Q ss_pred             HHHHHHHHHHCC
Q ss_conf             899998752059
Q gi|254780724|r  314 MRDLVKNCLRMR  325 (483)
Q Consensus       314 ~~~ll~~aLR~~  325 (483)
T Consensus        97 V~eNi~~~l~~~  108 (227)
T cd03260          97 IYDNVAYGLRLH  108 (227)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999999983