HHsearch alignment for GI: 254780724 and conserved domain: cd03261

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.00  E-value=0.001  Score=44.55  Aligned_cols=79  Identities=23%  Similarity=0.202  Sum_probs=49.2

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCH-------HHCCCCCCEEEEEEECCCCCCCCCCHHHH
Q ss_conf             98622588489981888888899999983038767679996421-------31256787567787416666530001899
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA-------ELQLQQPHVVRLETRPPNIEGEGEITMRD  316 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~-------El~l~~~~~v~~~~~~~~~e~~~~~t~~~  316 (483)
T Consensus        20 sl~i~~Ge~~~iiG~SGsGKSTll~~i~gL~~p~~G~I~~~g~~i~~~~~~~~~~~r~~-ig~vfQ~~~Lf~--~lTv~e   96 (235)
T cd03261          20 DLDVRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGEVLIDGEDISGLSEAELYRLRRR-MGMLFQSGALFD--SLTVFE   96 (235)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHHHHCC-EEEEECCCCCCC--CCCHHH
T ss_conf             64887998999999999729999999975999898589999999998998899997578-299704986589--996999


Q ss_pred             HHHHHHHCC
Q ss_conf             998752059
Q gi|254780724|r  317 LVKNCLRMR  325 (483)
Q Consensus       317 ll~~aLR~~  325 (483)
T Consensus        97 Nv~~~l~~~  105 (235)
T cd03261          97 NVAFPLREH  105 (235)
T ss_pred             HHHHHHHHH
T ss_conf             999999995