HHsearch alignment for GI: 254780724 and conserved domain: cd03294

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.02  E-value=0.00085  Score=45.16  Aligned_cols=104  Identities=21%  Similarity=0.210  Sum_probs=62.3

Q ss_pred             CCCCCCCHHHHHHCCCCCHHHH---------HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHH
Q ss_conf             5765466788865069988999---------9989862258848998188888889999998303876767999642131
Q gi|254780724|r  219 FKKDKLTLDHLVSFGAVTAEGA---------RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL  289 (483)
Q Consensus       219 ~~~~~~~l~~l~~~g~~~~~~~---------~~l~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El  289 (483)
T Consensus        10 f~~~~~~~~~~~~~~~~~e~v~K~fG~~~aL~~vsl~i~~GE~~~ivG~SGsGKSTLLr~i~GL~~p~~G~I~~~G~~i~   89 (269)
T cd03294          10 FGKNPQKAFKLLAKGKSKEEILKKTGQTVGVNDVSLDVREGEIFVIMGLSGSGKSTLLRCINRLIEPTSGKVLIDGQDIA   89 (269)
T ss_pred             CCCCHHHHHHHHHCCCCHHHEEEECCCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECC
T ss_conf             18998999999875998788588509927977747588899999999899848999999997599999759999999999


Q ss_pred             CCC-------CCCEEEEEEECCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             256-------78756778741666653000189999875205
Q gi|254780724|r  290 QLQ-------QPHVVRLETRPPNIEGEGEITMRDLVKNCLRM  324 (483)
Q Consensus       290 ~l~-------~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~  324 (483)
T Consensus        90 ~~~~~~l~~~r~~~igmVFQ~~aL~--P~ltV~eNV~~~L~~  129 (269)
T cd03294          90 AMSRKELRELRRKKISMVFQSFALL--PHRTVLENVAFGLEV  129 (269)
T ss_pred             CCCHHHHHHHHCCCEEEEEECCCCC--CCCCHHHHHHHHHHH
T ss_conf             9998999885256469996157547--678799998688885