HHsearch alignment for GI: 254780724 and conserved domain: cd03297

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.13  E-value=0.0028  Score=41.55  Aligned_cols=74  Identities=20%  Similarity=0.251  Sum_probs=46.7

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCH------H-HCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             88489981888888899999983038767679996421------3-1256787567787416666530001899998752
Q gi|254780724|r  250 RCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA------E-LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCL  322 (483)
Q Consensus       250 ~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~------E-l~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aL  322 (483)
T Consensus        23 ge~~~iiGpSGsGKSTll~~i~GL~~p~sG~I~~~G~~~~~~~~~~~~~~~~r~ig~VfQ~~~Lfp--~ltV~eNi~~~l  100 (214)
T cd03297          23 EEVTGIFGASGAGKSTLLRCIAGLEKPDGGTIVLNGTVLFDSRKKINLPPQQRKIGLVFQQYALFP--HLNVRENLAFGL  100 (214)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCCCCCCCCCCCCEEEEECCCCCCC--CCCHHHHHHHHH
T ss_conf             979999999973599999999849999964999999997665412467713487589767876578--891999998887


Q ss_pred             HCC
Q ss_conf             059
Q gi|254780724|r  323 RMR  325 (483)
Q Consensus       323 R~~  325 (483)
T Consensus       101 ~~~  103 (214)
T cd03297         101 KRK  103 (214)
T ss_pred             CCC
T ss_conf             679