HHsearch alignment for GI: 254780724 and conserved domain: cd03299

>cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=97.29  E-value=0.00094  Score=44.85  Aligned_cols=78  Identities=18%  Similarity=0.218  Sum_probs=51.0

Q ss_pred             HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECC--HHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             9862258848998188888889999998303876767999642--13125678756778741666653000189999875
Q gi|254780724|r  244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT--AELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNC  321 (483)
Q Consensus       244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~--~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~a  321 (483)
T Consensus        19 s~~v~~Ge~~~iiGpSGsGKSTLlr~i~Gl~~p~~G~I~~~G~di~~~~~~~-r~ig~vfQ~~~Lf--p~~tV~eNi~~~   95 (235)
T cd03299          19 SLEVERGDYFVILGPTGSGKSVLLETIAGFIKPDSGKILLNGKDITNLPPEK-RDISYVPQNYALF--PHMTVYKNIAYG   95 (235)
T ss_pred             EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHH-CCEEEECCCCCCC--CCCCHHHHHHHH
T ss_conf             8798899899999999635999999997499999659999999999999767-8978945798668--999099999999


Q ss_pred             HHC
Q ss_conf             205
Q gi|254780724|r  322 LRM  324 (483)
Q Consensus       322 LR~  324 (483)
T Consensus        96 l~~   98 (235)
T cd03299          96 LKK   98 (235)
T ss_pred             HHH
T ss_conf             987