>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.12 E-value=0.00066 Score=45.90 Aligned_cols=79 Identities=16% Similarity=0.133 Sum_probs=49.1 Q ss_pred HHHHCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCCC-CCCEEEEEEECCCCCCCCCCHHHHHHHHHH Q ss_conf 9862258848998188888889999998303876767999642131256-787567787416666530001899998752 Q gi|254780724|r 244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ-QPHVVRLETRPPNIEGEGEITMRDLVKNCL 322 (483) Q Consensus 244 ~~~v~~~~nilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l~-~~~~v~~~~~~~~~e~~~~~t~~~ll~~aL 322 (483) T Consensus 20 sl~v~~Ge~~~iiGpSGsGKSTllr~i~Gl~~p~~G~I~~~g~~v~~~~~~~r~ig~VfQ~~~Lf--p~ltV~~Nva~~l 97 (232) T cd03300 20 SLDIKEGEFFTLLGPSGCGKTTLLRLIAGFETPTSGEILLDGKDITNLPPHKRPVNTVFQNYALF--PHLTVFENIAFGL 97 (232) T ss_pred EEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEECCEECCCCCHHHCCEEEEECCCCCC--CCCCHHHHHHHHH T ss_conf 74887998999999999839999999977999985399999999999995457756991488547--7891999987799 Q ss_pred HC Q ss_conf 05 Q gi|254780724|r 323 RM 324 (483) Q Consensus 323 R~ 324 (483) T Consensus 98 ~~ 99 (232) T cd03300 98 RL 99 (232) T ss_pred HH T ss_conf 87

HHsearch alignment for GI: 254780724 and conserved domain: cd03300