HHsearch alignment for GI: 254780724 and conserved domain: pfam00004

>pfam00004 AAA ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.
Probab=96.87  E-value=0.0028  Score=41.50  Aligned_cols=66  Identities=29%  Similarity=0.531  Sum_probs=43.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEC
Q ss_conf             89981888888899999983038767679996421312567875677874166665300018999987520599889965
Q gi|254780724|r  253 VLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILG  332 (483)
Q Consensus       253 ilVsG~TGSGKTT~L~al~~~i~~~~rivtIED~~El~l~~~~~v~~~~~~~~~e~~~~~t~~~ll~~aLR~~PD~IiVG  332 (483)
T Consensus         1 iLl~GppGtGKT~~a~~la~~~~~~--~~~v~~~-~~-------~------~~~~g~~~~~i~~~f~~a~~~~p~Il~iD   64 (131)
T pfam00004         1 LLLYGPPGTGKTTLAKAVAKELGAP--FIEISGS-EL-------V------SKYVGESEKRLRELFEAAKKLAPCVIFID   64 (131)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHCCC--CEECCCC-CC-------C------CCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             9878999999999999999997898--5332420-12-------2------23345068889999999997499189831


Q ss_pred             CC
Q ss_conf             75
Q gi|254780724|r  333 EV  334 (483)
Q Consensus       333 Ei  334 (483)
T Consensus        65 e~   66 (131)
T pfam00004        65 EI   66 (131)
T ss_pred             HH
T ss_conf             16