HHsearch alignment for GI: 254780724 and conserved domain: pfam00270

>pfam00270 DEAD DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.
Probab=96.23  E-value=0.015  Score=36.40  Aligned_cols=50  Identities=28%  Similarity=0.200  Sum_probs=33.0

Q ss_pred             HHHHHHCCCCCEEEECCCCCCHHHH-HHHHHHHCC---CCCCEEEEECCHHHCCC
Q ss_conf             9898622588489981888888899-999983038---76767999642131256
Q gi|254780724|r  242 LLQIIGRIRCNVLISGGTGSGKTTL-LNCLTRYID---KDERIVTCEDTAELQLQ  292 (483)
Q Consensus       242 ~l~~~v~~~~nilVsG~TGSGKTT~-L~al~~~i~---~~~rivtIED~~El~l~  292 (483)
T Consensus         7 ~i~~~~-~g~~~iv~~pTGsGKT~~~~~~~l~~~~~~~~~~~~v~l~Pt~aL~~q   60 (167)
T pfam00270         7 AIPAIL-EGKDVLVQAPTGSGKTLAFLLPALQALLKNPDGPQALVLAPTRELAEQ   60 (167)
T ss_pred             HHHHHH-CCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHH
T ss_conf             999997-699789988999758999999999998747789879999060888889