HHsearch alignment for GI: 254780724 and conserved domain: pfam01580

>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive sequence similarity to wide variety of proteins from prokaryotes and plasmids, termed the FtsK/SpoIIIE family. This domain contains a putative ATP binding P-loop motif. It is found in the FtsK cell division protein from E. coli and the stage III sporulation protein E SpoIIIE which has roles in regulation of prespore specific gene expression in B. subtilis. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer.
Probab=96.69  E-value=0.0016  Score=43.17  Aligned_cols=35  Identities=40%  Similarity=0.544  Sum_probs=24.4

Q ss_pred             CCEEEECCCCCCHHHHHHHHHHH----CCC-CCCEEEEECC
Q ss_conf             84899818888888999999830----387-6767999642
Q gi|254780724|r  251 CNVLISGGTGSGKTTLLNCLTRY----IDK-DERIVTCEDT  286 (483)
Q Consensus       251 ~nilVsG~TGSGKTT~L~al~~~----i~~-~~rivtIED~  286 (483)
T Consensus        39 pH~Lv~G~tGsGKS~~l~~li~sl~~~~~p~~v~l~li-D~   78 (202)
T pfam01580        39 PHLLIAGATGSGKSTFLNTLILSLAARHSPEEVRLYLI-DP   78 (202)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEE-CC
T ss_conf             86899658999800999999999987379620699997-48