HHsearch alignment for GI: 254780724 and conserved domain: pfam06745

>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=97.30  E-value=0.0019  Score=42.75  Aligned_cols=166  Identities=17%  Similarity=0.212  Sum_probs=78.2

Q ss_pred             HCCCCCEEEECCCCCCHHHHHHHHH-H-HCCCCCCEE--EEECCHHHCCCC-------------CCEEEE-EEECCC---
Q ss_conf             2258848998188888889999998-3-038767679--996421312567-------------875677-874166---
Q gi|254780724|r  247 GRIRCNVLISGGTGSGKTTLLNCLT-R-YIDKDERIV--TCEDTAELQLQQ-------------PHVVRL-ETRPPN---  305 (483)
Q Consensus       247 v~~~~nilVsG~TGSGKTT~L~al~-~-~i~~~~riv--tIED~~El~l~~-------------~~~v~~-~~~~~~---  305 (483)
T Consensus        16 i~~gs~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~ee~~~~l~~~~~~~g~~~~~~~~~g~l~i~d~~~~~~~~   95 (231)
T pfam06745        16 IPEGRVVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLEEPPEDLRENAKSFGWDLEKLEEEGKLAIIDASTSGIGI   95 (231)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCCCHHHHHHCCCEEEEECCCCCCCC
T ss_conf             82996999985897259999999999999865896899981379999999999829985898646967898625442221


Q ss_pred             CCCCCCCHHH----HHHHHHHHCCCCEEEECCCCCH-------HHHHHH----H-HHHCCCCEEEHHHCCCCHHHHHHHH
Q ss_conf             6653000189----9998752059988996575879-------999999----9-9873970102000478888899999
Q gi|254780724|r  306 IEGEGEITMR----DLVKNCLRMRPERIILGEVRGP-------EVLDLL----Q-AMNTGHDGSMGTIHANNARESFGRM  369 (483)
Q Consensus       306 ~e~~~~~t~~----~ll~~aLR~~PD~IiVGEiRg~-------Ea~~~l----~-A~~TGH~G~ltTlHa~s~~~ai~RL  369 (483)
T Consensus        96 ~~~~~~~~~~~~~~~i~~~i~~~~~~~vVIDsit~l~~~~~~~~~r~~l~~l~~~lk~~g~t-~l~t~e~~~~~~~~~--  172 (231)
T pfam06745        96 AEVKGRFDLEELIERLREAIREIGAKRVVIDSITTLFYLLKPAMAREILRRLKRVLKKLGVT-AIFTSEKPSGEGGIG--  172 (231)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCHHHHHCCCHHHHHHHHHHHHHHHHHCCCE-EEEEEEECCCCCCCC--
T ss_conf             00112279999999999999971998899976416400588999999999999999976991-999982125777656--


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCCEEEEEEECCCCC--EEEEEEEEEEEEECCEEEEEEEEEEEEE
Q ss_conf             9755304679998999999974235889998769998--7899999998414988998678987540
Q gi|254780724|r  370 EAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS--RRITNICEIVGMEGNVIITQDLLKYEVM  434 (483)
Q Consensus       370 ~~m~~~~~~~~~~~~~~~~ia~avd~iV~~~r~~dG~--Rrv~~I~Ev~g~e~~~~~~~~if~~~~~  434 (483)
T Consensus       173 ------------~~~~~~---~l~D~vI~L~~~~~~~~~~R~l~I~K~Rg~~----~~~~~~~f~It  220 (231)
T pfam06745       173 ------------GYGVEE---FVVDGVIRLDLKEIEGELVRTIEIVKMRGTP----HSMKRYPFEIT  220 (231)
T ss_pred             ------------CCCHHH---HEEEEEEEEEEECCCCEEEEEEEEEECCCCC----CCCCEEEEEEE
T ss_conf             ------------763011---1003699999882499899999999866998----78947999990