BLAST/PSIBLAST alignment of GI: 254780724 and GI: 190889884 at iteration 1
>gi|190889884|ref|YP_001976426.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CIAT 652] Length = 492
>gi|190695163|gb|ACE89248.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CIAT 652] Length = 492
>gi|327194691|gb|EGE61537.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CNPAF512] Length = 492
 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/449 (69%), Positives = 379/449 (84%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT 92
           + Q  Q + P  +        RT  YY+ K  +F+ LI+ ID++QLS+ D +SAR+EI  
Sbjct: 43  ENQRQQVTPPPMQAPQRKRPVRTDEYYDTKQQVFSALIDTIDLSQLSKLDGESAREEIRD 102

Query: 93  LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVN 152
           ++N+I+++K   MS+ EQ +L ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV 
Sbjct: 103 IVNDIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVG 162

Query: 153 GKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGP 212
           GKT+E+ I FRDN QLLS+CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP
Sbjct: 163 GKTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGP 222

Query: 213 TLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTR 272
            LTIRKFKKDKLTLD LV FGA+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT 
Sbjct: 223 ALTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLTN 282

Query: 273 YIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILG 332
           YID+DER++TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+G
Sbjct: 283 YIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVG 342

Query: 333 EVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSS 392
           EVRGPEV DLLQAMNTGHDGSMGTIHAN  RE   R+E+MIAMGGFTLP++ VREII++S
Sbjct: 343 EVRGPEVFDLLQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISTS 402

Query: 393 LDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
           +DVI+Q  RLRDGSRRIT I E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV 
Sbjct: 403 VDVIIQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMSTGVG 462

Query: 453 RPRFWNRAAQYGEEKNLAEVLQSLEKQSR 481
           +P FW+RA  + EEK LA  L ++E +++
Sbjct: 463 KPHFWDRARYFNEEKRLAAALDAMEAKTK 491