BLAST/PSIBLAST alignment of GI: 254780724 and GI: 241207160 at iteration 1
>gi|241207160|ref|YP_002978256.1| type II secretion system protein E [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 491
>gi|240861050|gb|ACS58717.1| type II secretion system protein E [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 491
 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/428 (72%), Positives = 374/428 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ K+ +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 63  RTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDIVNDIITIKNFAMSISEQEEL 122

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 123 LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 182

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 183 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFG 242

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++TCEDTAELQLQQ
Sbjct: 243 AITPEGATVLQIIGRVRCNVVISGGTGSGKTTLLNCLTNYIDRDERVITCEDTAELQLQQ 302

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 303 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 362

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   R+E+MIAMGGFTLP++ VREII+SS+DV++Q  RLRDGSRRIT I 
Sbjct: 363 MGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISSSVDVVIQAARLRDGSRRITQIT 422

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P FW+RA  + EEK LA  L
Sbjct: 423 EVIGMEGDVIITQDLMRYEIDGEDANGRLIGRHMSTGVGKPHFWDRARYFNEEKRLAAAL 482

Query: 474 QSLEKQSR 481
            ++E +++
Sbjct: 483 DAMEAKTK 490