BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780724|ref|YP_003065137.1| component of type IV pilus
[Candidatus Liberibacter asiaticus str. psy62]
         (483 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780724|ref|YP_003065137.1| component of type IV pilus [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040401|gb|ACT57197.1| component of type IV pilus [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 483

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/483 (100%), Positives = 483/483 (100%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE 60
           MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE
Sbjct: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE 60

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND
Sbjct: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG
Sbjct: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA
Sbjct: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE
Sbjct: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN
Sbjct: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG
Sbjct: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQS 480
           NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQS
Sbjct: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQS 480

Query: 481 RAL 483
           RAL
Sbjct: 481 RAL 483


>gi|315121888|ref|YP_004062377.1| component of type IV pilus [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495290|gb|ADR51889.1| component of type IV pilus [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 488

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/488 (80%), Positives = 433/488 (88%), Gaps = 8/488 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNL----QSSSPSAEGEIG--NFV-N 53
           MFG+R+K  +GS  RE N  L QE       I+        QSS      E+G  N + +
Sbjct: 1   MFGKREKGPIGSANRE-NFKLRQEKAQQGKEIEDSGSDGTNQSSFLDQSSELGLPNILKH 59

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ HYY++K+T+F TLIEMIDIT+LSQYD + A+ EIA LM+EI+S+K I M  +E+ DL
Sbjct: 60  RSSHYYDIKATVFGTLIEMIDITKLSQYDGELAKKEIAELMDEIISIKDIVMPFEEKEDL 119

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            EDL NDILGYGPLQPLIARDDIADIMVNG +KVFIEVNGKT+ETGI+FR+NEQLLSVCQ
Sbjct: 120 LEDLSNDILGYGPLQPLIARDDIADIMVNGPDKVFIEVNGKTIETGISFRNNEQLLSVCQ 179

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIVNQVGRRVDE+SPICDARLLDGSRVNVIIPPLALDG TLTIRKFKKDKLTLDHLV FG
Sbjct: 180 RIVNQVGRRVDEASPICDARLLDGSRVNVIIPPLALDGATLTIRKFKKDKLTLDHLVRFG 239

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T  G++LLQIIGR+RCN+LISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ
Sbjct: 240 AITEAGSQLLQIIGRVRCNILISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 299

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS
Sbjct: 300 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 359

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHANN RESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC
Sbjct: 360 MGTIHANNPRESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 419

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+VGMEGNVIITQDL+KY+V+G+DE+GKLIG H+ +GVSRPRFWNRAAQYGEEKNLAEVL
Sbjct: 420 EVVGMEGNVIITQDLIKYDVIGQDESGKLIGHHVGSGVSRPRFWNRAAQYGEEKNLAEVL 479

Query: 474 QSLEKQSR 481
           +S+EKQ R
Sbjct: 480 ESVEKQPR 487


>gi|325291656|ref|YP_004277520.1| component of type IV pilus [Agrobacterium sp. H13-3]
 gi|325059509|gb|ADY63200.1| component of type IV pilus [Agrobacterium sp. H13-3]
          Length = 490

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/427 (73%), Positives = 373/427 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY  K  +F+ LI+ ID++QL++ D++SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 64  RTEDYYNTKGQVFSALIDTIDLSQLAKLDAESAREEIRDIVNDIITIKNFAMSIAEQEEL 123

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNGS + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 124 LEDICNDVLGYGPLEPLLARDDIADIMVNGSGQTFIEVGGKTIESDIRFRDNGQLLSICQ 183

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 184 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 243

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA LL+IIGR+RCNV+ISGGTGSGKTTLLNCLT +IDKDER++TCEDTAELQLQQ
Sbjct: 244 AITPEGATLLKIIGRVRCNVVISGGTGSGKTTLLNCLTSFIDKDERVITCEDTAELQLQQ 303

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDL+KNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 304 PHVVRLETRPPNIEGEGEITMRDLIKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 363

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN  RE   R+E+MIAMGGFTLP++ VREII+ S+D+++Q QRLRDGSRRIT I 
Sbjct: 364 MGTLHANTPRECLSRIESMIAMGGFTLPAKTVREIISGSIDIVIQAQRLRDGSRRITQIT 423

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VI+TQDL++YE+ GED  GKLIG+H+STG+S+P FW+RA  YGEEK LA  L
Sbjct: 424 EVIGMEGDVIVTQDLMRYEIDGEDAHGKLIGKHVSTGISKPHFWDRARYYGEEKRLATAL 483

Query: 474 QSLEKQS 480
             +EK S
Sbjct: 484 DEMEKTS 490


>gi|159184215|ref|NP_353251.2| component of type IV pilus [Agrobacterium tumefaciens str. C58]
 gi|159139544|gb|AAK86036.2| component of type IV pilus [Agrobacterium tumefaciens str. C58]
          Length = 491

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/427 (72%), Positives = 373/427 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY  KS +F+ LI+ ID++QL++ D++SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 65  RTEDYYNTKSQVFSALIDTIDLSQLAKLDAESAREEIRDIVNDIITIKNFAMSIAEQEEL 124

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNGS + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 125 LEDICNDVLGYGPLEPLLARDDIADIMVNGSGQTFIEVGGKTIESDIRFRDNAQLLSICQ 184

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFK+DKLTLD LV FG
Sbjct: 185 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKRDKLTLDQLVRFG 244

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA LL+IIGR+RCNV+ISGGTGSGKTTLLNCLT +IDKDER++TCEDTAELQLQQ
Sbjct: 245 AITPEGATLLKIIGRVRCNVVISGGTGSGKTTLLNCLTSFIDKDERVITCEDTAELQLQQ 304

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERI++GEVRGPEV DLLQAMNTGHDGS
Sbjct: 305 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIVVGEVRGPEVFDLLQAMNTGHDGS 364

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN  RE   R+E+MIAMGGFTLP++ VREII+ S+DV++Q  RLRDGSRRIT I 
Sbjct: 365 MGTLHANTPRECLSRIESMIAMGGFTLPAKTVREIISGSIDVVIQAARLRDGSRRITQIT 424

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VI+TQDL++YE+ GED  G+LIG+H+STG+S+P FW+RA  YGE+K LA  L
Sbjct: 425 EVIGMEGDVIVTQDLMRYEIEGEDAQGRLIGRHVSTGISKPHFWDRARYYGEDKRLAAAL 484

Query: 474 QSLEKQS 480
             +EK S
Sbjct: 485 DEMEKSS 491


>gi|209551762|ref|YP_002283679.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537518|gb|ACI57453.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 491

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/428 (73%), Positives = 375/428 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ K+ +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 63  RTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDIVNDIITIKNFAMSISEQEEL 122

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 123 LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 182

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 183 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFG 242

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+TAEGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++TCEDTAELQLQQ
Sbjct: 243 AITAEGATVLQIIGRVRCNVVISGGTGSGKTTLLNCLTNYIDRDERVITCEDTAELQLQQ 302

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 303 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 362

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   R+E+MIAMGGFTLP++ VREII+SS+DVI+Q  RLRDGSRRIT I 
Sbjct: 363 MGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISSSVDVIIQAARLRDGSRRITQIT 422

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P FW+RA  + EEK LA  L
Sbjct: 423 EVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMSTGVGKPHFWDRARYFNEEKRLAAAL 482

Query: 474 QSLEKQSR 481
            ++E +++
Sbjct: 483 DAMEAKTK 490


>gi|241207160|ref|YP_002978256.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861050|gb|ACS58717.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 491

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/428 (72%), Positives = 374/428 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ K+ +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 63  RTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDIVNDIITIKNFAMSISEQEEL 122

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 123 LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 182

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 183 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFG 242

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++TCEDTAELQLQQ
Sbjct: 243 AITPEGATVLQIIGRVRCNVVISGGTGSGKTTLLNCLTNYIDRDERVITCEDTAELQLQQ 302

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 303 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 362

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   R+E+MIAMGGFTLP++ VREII+SS+DV++Q  RLRDGSRRIT I 
Sbjct: 363 MGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISSSVDVVIQAARLRDGSRRITQIT 422

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P FW+RA  + EEK LA  L
Sbjct: 423 EVIGMEGDVIITQDLMRYEIDGEDANGRLIGRHMSTGVGKPHFWDRARYFNEEKRLAAAL 482

Query: 474 QSLEKQSR 481
            ++E +++
Sbjct: 483 DAMEAKTK 490


>gi|116249984|ref|YP_765822.1| component of pilus [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254632|emb|CAK05706.1| putative component of pilus [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 491

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/428 (72%), Positives = 374/428 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ K+ +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 63  RTDEYYDTKAQVFSALIDTIDLSQLSKLDGESAREEIRDIVNDIITIKNFAMSISEQEEL 122

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 123 LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 182

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 183 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFG 242

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++TCEDTAELQLQQ
Sbjct: 243 AITPEGATVLQIIGRVRCNVVISGGTGSGKTTLLNCLTNYIDRDERVITCEDTAELQLQQ 302

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 303 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 362

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   R+E+MIAMGGFTLP++ VREII+SS+DV++Q  RLRDGSRRIT I 
Sbjct: 363 MGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISSSVDVVIQAARLRDGSRRITQIT 422

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G+L+G+H+STGV +P FW+RA  + EEK LA  L
Sbjct: 423 EVIGMEGDVIITQDLMRYEIEGEDANGRLVGRHMSTGVGKPHFWDRARYFNEEKRLAAAL 482

Query: 474 QSLEKQSR 481
            ++E +++
Sbjct: 483 DAMEAKTK 490


>gi|190889884|ref|YP_001976426.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CIAT
           652]
 gi|190695163|gb|ACE89248.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CIAT
           652]
 gi|327194691|gb|EGE61537.1| pilus assembly secretion ATP-binding protein [Rhizobium etli
           CNPAF512]
          Length = 492

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/449 (69%), Positives = 379/449 (84%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT 92
           + Q  Q + P  +        RT  YY+ K  +F+ LI+ ID++QLS+ D +SAR+EI  
Sbjct: 43  ENQRQQVTPPPMQAPQRKRPVRTDEYYDTKQQVFSALIDTIDLSQLSKLDGESAREEIRD 102

Query: 93  LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVN 152
           ++N+I+++K   MS+ EQ +L ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV 
Sbjct: 103 IVNDIITIKNFAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVG 162

Query: 153 GKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGP 212
           GKT+E+ I FRDN QLLS+CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP
Sbjct: 163 GKTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGP 222

Query: 213 TLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTR 272
            LTIRKFKKDKLTLD LV FGA+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT 
Sbjct: 223 ALTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLTN 282

Query: 273 YIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILG 332
           YID+DER++TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+G
Sbjct: 283 YIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVG 342

Query: 333 EVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSS 392
           EVRGPEV DLLQAMNTGHDGSMGTIHAN  RE   R+E+MIAMGGFTLP++ VREII++S
Sbjct: 343 EVRGPEVFDLLQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISTS 402

Query: 393 LDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
           +DVI+Q  RLRDGSRRIT I E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV 
Sbjct: 403 VDVIIQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMSTGVG 462

Query: 453 RPRFWNRAAQYGEEKNLAEVLQSLEKQSR 481
           +P FW+RA  + EEK LA  L ++E +++
Sbjct: 463 KPHFWDRARYFNEEKRLAAALDAMEAKTK 491


>gi|163757630|ref|ZP_02164719.1| putative pilus assembly protein [Hoeflea phototrophica DFL-43]
 gi|162285132|gb|EDQ35414.1| putative pilus assembly protein [Hoeflea phototrophica DFL-43]
          Length = 501

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/427 (72%), Positives = 372/427 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   YY+ KS +F+ LI+ ID++QL++ D++SAR+EI  ++N+I+++K   +S+ EQ +L
Sbjct: 74  RNEAYYDTKSQVFSALIDTIDLSQLAKLDAESAREEIRDIVNDIITIKNFALSIAEQEEL 133

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIADIMVNG+ K +IEV+GK  ET + FRDN QLLS+CQ
Sbjct: 134 LDDICNDVLGYGPLEPLLARDDIADIMVNGAGKTYIEVSGKVQETDVRFRDNGQLLSICQ 193

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTLD LV FG
Sbjct: 194 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGAALTIRKFKKDKLTLDQLVKFG 253

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA LLQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID DER++TCED+AELQLQQ
Sbjct: 254 AITPEGAVLLQIIGRVRCNVVISGGTGSGKTTLLNCLTAYIDTDERVITCEDSAELQLQQ 313

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERI++GEVRGPEV DLLQAMNTGHDGS
Sbjct: 314 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIVVGEVRGPEVFDLLQAMNTGHDGS 373

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN+ RE   RME+MIAMGGFTLP++ VREII+ S+DV++Q  RLRDGSRRIT+I 
Sbjct: 374 MGTIHANSPRECLSRMESMIAMGGFTLPAKTVREIISGSVDVVIQATRLRDGSRRITHIT 433

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+VGMEG+VIITQDL+KYE++GED  GK+IG+H STG+ RP FW+RA  YGE+K LA  L
Sbjct: 434 EVVGMEGDVIITQDLMKYEMVGEDANGKIIGEHRSTGIGRPHFWDRARYYGEDKRLAAAL 493

Query: 474 QSLEKQS 480
            ++EK +
Sbjct: 494 DAMEKMT 500


>gi|86355867|ref|YP_467759.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CFN
           42]
 gi|86279969|gb|ABC89032.1| pilus assembly secretion ATP-binding protein [Rhizobium etli CFN
           42]
          Length = 491

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/428 (72%), Positives = 373/428 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ K  +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 63  RTDEYYDTKQQVFSALIDTIDLSQLSKLDGESAREEIRDIVNDIITIKNFAMSISEQEEL 122

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 123 LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 182

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 183 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFG 242

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++TCEDTAELQLQQ
Sbjct: 243 AITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLTNYIDRDERVITCEDTAELQLQQ 302

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 303 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 362

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   R+E+MIAMGGF+LP++ VREII++S+DVI+Q  RLRDGSRRIT I 
Sbjct: 363 MGTIHANTPRECLSRIESMIAMGGFSLPAKTVREIISTSVDVIIQAARLRDGSRRITQIT 422

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P FW+RA  + EEK LA  L
Sbjct: 423 EVIGMEGDVIITQDLMRYEIDGEDAGGRLIGRHMSTGVGKPHFWDRARYFNEEKRLAAAL 482

Query: 474 QSLEKQSR 481
            ++E +S+
Sbjct: 483 DAMEAKSK 490


>gi|222084472|ref|YP_002543001.1| pilus assembly secretion ATP-binding protein [Agrobacterium
           radiobacter K84]
 gi|221721920|gb|ACM25076.1| pilus assembly secretion ATP-binding protein [Agrobacterium
           radiobacter K84]
          Length = 438

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/428 (72%), Positives = 371/428 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           RT  YY+ KS +F  LI+ ID++QLS+ D+++AR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 11  RTEEYYDTKSQVFAALIDTIDLSQLSKLDAEAAREEIRDIVNDIITIKNFAMSISEQEEL 70

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I FRDN QLLS+CQ
Sbjct: 71  LEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRFRDNAQLLSICQ 130

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 131 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPVLTIRKFKKDKLTLDQLVRFG 190

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA LLQIIGR+RCN++ISGGTGSGKTTLLNCLT YID+ ER++TCEDTAELQLQQ
Sbjct: 191 AITPEGATLLQIIGRVRCNIVISGGTGSGKTTLLNCLTNYIDRHERVITCEDTAELQLQQ 250

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 251 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 310

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN  RE   R+E+MIAMGG++LP++ VREII++S+DVIVQ  RLRDGSRRIT I 
Sbjct: 311 MGTLHANTPRECLSRIESMIAMGGYSLPAKTVREIISTSVDVIVQAARLRDGSRRITQIT 370

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQDL++YE+ GED  G++IG+H+STGV +P FW+RA  Y EEK LA  L
Sbjct: 371 EVIGMEGDVIITQDLMRYEMEGEDANGRIIGRHMSTGVGKPHFWDRARYYNEEKRLAAAL 430

Query: 474 QSLEKQSR 481
             +E  S+
Sbjct: 431 DEMENNSK 438


>gi|150398544|ref|YP_001329011.1| type II secretion system protein E [Sinorhizobium medicae WSM419]
 gi|150030059|gb|ABR62176.1| type II secretion system protein E [Sinorhizobium medicae WSM419]
          Length = 488

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 388/488 (79%), Gaps = 9/488 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQ-----SSSPSAEGEIGNFVNRT 55
           MFG+R  +  G        P P    V  + +++ +       ++ PS          R 
Sbjct: 1   MFGKRGNEGPGKGGARGFTPAPSIPAVELAVVERPSAPDYGEPAAPPSRPQAAAPPQRRR 60

Query: 56  P----HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
           P     YY+ KS +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ 
Sbjct: 61  PARAEDYYDTKSQVFSALIDTIDLSQLSKLDIESAREEIRDIVNDIITIKNFAMSISEQE 120

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           +L +D+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GK  E+ I FRDN QLLS+
Sbjct: 121 ELLDDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKVEESEIRFRDNGQLLSI 180

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
           CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTL+ LV 
Sbjct: 181 CQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLEQLVR 240

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG+VT E A LLQIIGR+RCN++ISGGTGSGKTTLLNCLTRYID +ERI+TCED+AELQL
Sbjct: 241 FGSVTPEAAVLLQIIGRVRCNIVISGGTGSGKTTLLNCLTRYIDSNERIITCEDSAELQL 300

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHD
Sbjct: 301 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHD 360

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSMGTIHAN  RE   RME+MIAMGG+TLP++ VREII+ S+DVI+Q  RLRDGSRRIT+
Sbjct: 361 GSMGTIHANTPRECLSRMESMIAMGGYTLPARTVREIISGSVDVIIQASRLRDGSRRITH 420

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
           I E+VGMEG+VIITQDL++YE+ GED  G+++G+H+STG+ RP FW+RA  + E+K LA 
Sbjct: 421 ITEVVGMEGDVIITQDLMRYEIDGEDANGRIVGRHVSTGIGRPHFWDRARYFNEDKRLAA 480

Query: 472 VLQSLEKQ 479
            L ++EKQ
Sbjct: 481 TLDAMEKQ 488


>gi|307315794|ref|ZP_07595308.1| type II secretion system protein E [Sinorhizobium meliloti BL225C]
 gi|307320429|ref|ZP_07599846.1| type II secretion system protein E [Sinorhizobium meliloti AK83]
 gi|306893995|gb|EFN24764.1| type II secretion system protein E [Sinorhizobium meliloti AK83]
 gi|306898562|gb|EFN29235.1| type II secretion system protein E [Sinorhizobium meliloti BL225C]
          Length = 489

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/488 (65%), Positives = 386/488 (79%), Gaps = 9/488 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLP-----QEVVVSSSNIQKQNLQSSSPS----AEGEIGNF 51
           MFG+R  +  G       +P P     Q V V  S         ++PS    A       
Sbjct: 1   MFGKRGNEGPGKGGARGFSPAPPMPAVQPVPVERSAAPVLGETVAAPSRPQAAAPPQRRR 60

Query: 52  VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
             R   YY+ KS +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ 
Sbjct: 61  APRAEDYYDTKSQVFSALIDTIDLSQLSKLDIESAREEIRDIVNDIITIKNFAMSISEQE 120

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           +L +D+CND+LGYGPL+PL+ARDDIADIMVNG+ ++FIEV GK  E+ I FRDN QLLS+
Sbjct: 121 ELLDDICNDVLGYGPLEPLLARDDIADIMVNGAGQIFIEVGGKVEESEIRFRDNGQLLSI 180

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
           CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTL+ LV 
Sbjct: 181 CQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLEQLVR 240

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG++T E A LLQIIGR+RCN++ISGGTGSGKTTLLNCLTRYID  ERI+TCED+AELQL
Sbjct: 241 FGSITPEAAVLLQIIGRVRCNIVISGGTGSGKTTLLNCLTRYIDSTERIITCEDSAELQL 300

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHD
Sbjct: 301 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHD 360

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSMGTIHAN  RE   RME+MIAMGG+TLP++ VREII+ S+DVI+Q  RLRDGSRRIT+
Sbjct: 361 GSMGTIHANTPRECLSRMESMIAMGGYTLPARTVREIISGSVDVIIQASRLRDGSRRITH 420

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
           I E+ GMEG+VIITQDL++YE+ GED  G+++G+H+STG+ RP FW+RA  + E+K LA 
Sbjct: 421 ITEVTGMEGDVIITQDLMRYEIDGEDANGRIVGRHVSTGIGRPHFWDRARYFNEDKRLAA 480

Query: 472 VLQSLEKQ 479
            L ++EKQ
Sbjct: 481 TLDAMEKQ 488


>gi|15963897|ref|NP_384250.1| putative pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|15073072|emb|CAC41531.1| Putative pilus assembly protein [Sinorhizobium meliloti 1021]
          Length = 466

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/426 (71%), Positives = 367/426 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   YY+ KS +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 40  RAEDYYDTKSQVFSALIDTIDLSQLSKLDIESAREEIRDIVNDIITIKNFAMSISEQEEL 99

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIADIMVNG+ ++FIEV GK  E+ I FRDN QLLS+CQ
Sbjct: 100 LDDICNDVLGYGPLEPLLARDDIADIMVNGAGQIFIEVGGKVEESEIRFRDNGQLLSICQ 159

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTL+ LV FG
Sbjct: 160 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLEQLVRFG 219

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           ++T E A LLQIIGR+RCN++ISGGTGSGKTTLLNCLTRYID  ERI+TCED+AELQLQQ
Sbjct: 220 SITPEAAVLLQIIGRVRCNIVISGGTGSGKTTLLNCLTRYIDSTERIITCEDSAELQLQQ 279

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 280 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 339

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN  RE   RME+MIAMGG+TLP++ VREII+ S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 340 MGTIHANTPRECLSRMESMIAMGGYTLPARTVREIISGSVDVIIQASRLRDGSRRITHIT 399

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+ GMEG+VIITQDL++YE+ GED  G+++G+H+STG+ RP FW+RA  + E+K LA  L
Sbjct: 400 EVTGMEGDVIITQDLMRYEIDGEDANGRIVGRHVSTGIGRPHFWDRARYFNEDKRLAATL 459

Query: 474 QSLEKQ 479
            ++EKQ
Sbjct: 460 DAMEKQ 465


>gi|13474663|ref|NP_106232.1| secretory protein kinase, cpaF [Mesorhizobium loti MAFF303099]
 gi|14025418|dbj|BAB52018.1| secretory protein kinase; CpaF [Mesorhizobium loti MAFF303099]
          Length = 502

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/423 (70%), Positives = 371/423 (87%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           YY+ KS +F+ LI+ ID++QL++ D ++AR+EI  ++N+I+++K   MS+ EQ +L ED+
Sbjct: 79  YYDTKSQVFSALIDTIDLSQLAKLDPETAREEIRDIVNDIIAIKNFAMSIAEQEELLEDI 138

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
           CND+LGYGPL+PL+ARDDIADIMVNGS  V+IEVNGK  +TGI FRDN+QLL++CQRIV+
Sbjct: 139 CNDVLGYGPLEPLLARDDIADIMVNGSKNVYIEVNGKVEQTGIRFRDNQQLLNICQRIVS 198

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTLD LV FGA++ 
Sbjct: 199 QVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLDQLVKFGAISP 258

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           +GA +L+IIGR+RCN++ISGGTGSGKTTLLNCLT YID+DER++TCED+AELQLQQPHVV
Sbjct: 259 QGAEVLKIIGRVRCNIVISGGTGSGKTTLLNCLTNYIDRDERVITCEDSAELQLQQPHVV 318

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGSMGTI
Sbjct: 319 RLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGSMGTI 378

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           H+N+ RE   R+E+MIAMGG++LP + VREI+  S+DVI+Q  RLRDGSRRIT+I E++G
Sbjct: 379 HSNSPRECLNRIESMIAMGGYSLPQKTVREIVVGSIDVIIQAARLRDGSRRITHITEVIG 438

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           MEG+VIITQD++ Y + GED  G+L+G+H+STG+ RP FW+RA  YGEE+ LA  L+++E
Sbjct: 439 MEGDVIITQDIVLYNIKGEDANGRLLGEHVSTGIGRPHFWDRARYYGEEQRLAVALEAME 498

Query: 478 KQS 480
           K++
Sbjct: 499 KRA 501


>gi|192292569|ref|YP_001993174.1| type II secretion system protein E [Rhodopseudomonas palustris
           TIE-1]
 gi|192286318|gb|ACF02699.1| type II secretion system protein E [Rhodopseudomonas palustris
           TIE-1]
          Length = 484

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/424 (70%), Positives = 365/424 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 56  RSENYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 115

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  V+IEV G+   TGI FRDN+QLL++CQ
Sbjct: 116 LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVYIEVAGRIQRTGIRFRDNQQLLNICQ 175

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 176 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 235

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA++LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 236 AITPEGAQILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 295

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG+ITMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 296 PHVVRLETRPPNIEGEGQITMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 355

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 356 MGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDVIIQAARLRDGSRRITHIT 415

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+ IITQD+  Y+++GED  G ++G+H STG+ RPRFW RA  +GEE+ LA  L
Sbjct: 416 EVMGMEGDTIITQDIFVYDLLGEDANGHIVGRHRSTGIGRPRFWERARYFGEEQRLAAAL 475

Query: 474 QSLE 477
            + E
Sbjct: 476 DAAE 479


>gi|316933036|ref|YP_004108018.1| type II secretion system protein E [Rhodopseudomonas palustris
           DX-1]
 gi|315600750|gb|ADU43285.1| type II secretion system protein E [Rhodopseudomonas palustris
           DX-1]
          Length = 486

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/424 (70%), Positives = 364/424 (85%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 58  RSDTYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 117

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  V+IEV G+   TGI FRDN+QLL++CQ
Sbjct: 118 LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVYIEVAGRIQRTGIRFRDNQQLLNICQ 177

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 178 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 237

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA++LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 238 AITPEGAQILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 297

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG+ITMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 298 PHVVRLETRPPNIEGEGQITMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 357

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+DVI+Q  RLRDGSRRIT++ 
Sbjct: 358 MGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDVIIQAARLRDGSRRITHVT 417

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+VGMEG+ IITQD+  Y+++GED  G ++G+H +TG+ RPRFW RA  YGEE+ LA  L
Sbjct: 418 EVVGMEGDTIITQDIFVYDLLGEDANGHIVGRHRATGIGRPRFWERARYYGEEQRLAAAL 477

Query: 474 QSLE 477
            + E
Sbjct: 478 DAAE 481


>gi|146338120|ref|YP_001203168.1| putative secretory protein kinase, cpaF-like gene [Bradyrhizobium
           sp. ORS278]
 gi|146190926|emb|CAL74931.1| putative secretory protein kinase, cpaF-like gene [Bradyrhizobium
           sp. ORS278]
          Length = 433

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/414 (72%), Positives = 362/414 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 5   RSDNYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 64

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDIADIMVNG+  VFIEVNGK   TGI FRDN+QLL++CQ
Sbjct: 65  LDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVFIEVNGKIQRTGIRFRDNQQLLNICQ 124

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 125 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 184

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA +LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DER++TCED AELQLQQ
Sbjct: 185 AISPEGAEILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDHDERVITCEDAAELQLQQ 244

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 245 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 304

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DVIVQ  RLRDGSRRIT+I 
Sbjct: 305 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVIVQAARLRDGSRRITHIT 364

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+ IITQD+  Y+++GED  GK+IG+H STG+ RPRFW RA  YGEEK
Sbjct: 365 EVMGMEGDTIITQDIFLYDMIGEDANGKIIGRHRSTGIGRPRFWERARYYGEEK 418


>gi|39936743|ref|NP_949019.1| type II secretion system protein E [Rhodopseudomonas palustris
           CGA009]
 gi|39650599|emb|CAE29122.1| secretory protein kinase, cpaF [Rhodopseudomonas palustris CGA009]
          Length = 460

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/424 (70%), Positives = 365/424 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 32  RSENYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 91

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  V+IEV G+   TGI FRDN+QLL++CQ
Sbjct: 92  LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVYIEVAGRIQRTGIRFRDNQQLLNICQ 151

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 152 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 211

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA++LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 212 AITPEGAQILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 271

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG+ITMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 272 PHVVRLETRPPNIEGEGQITMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 331

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 332 MGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDVIIQAARLRDGSRRITHIT 391

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+ IITQD+  Y+++GED  G ++G+H STG+ RPRFW RA  +GEE+ LA  L
Sbjct: 392 EVMGMEGDTIITQDIFVYDLLGEDANGHIVGRHRSTGIGRPRFWERARYFGEEQRLAAAL 451

Query: 474 QSLE 477
            + E
Sbjct: 452 DAAE 455


>gi|222147179|ref|YP_002548136.1| component of type IV pilus [Agrobacterium vitis S4]
 gi|221734169|gb|ACM35132.1| component of type IV pilus [Agrobacterium vitis S4]
          Length = 492

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/428 (71%), Positives = 375/428 (87%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           NRT  YY+ KS +F+ LI+ ID++QL++ D++SAR+EI  ++N+I+S+K   MS+ EQ +
Sbjct: 62  NRTEDYYDTKSQVFSALIDTIDLSQLAKLDAESAREEIRDIVNDIISIKNFAMSISEQEE 121

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L +D+CND+LGYGPL+PL+ARDDI+DIMVNG+ + FIEV GKT+E+ I FRDN QLLS+C
Sbjct: 122 LLDDICNDVLGYGPLEPLLARDDISDIMVNGAGQTFIEVGGKTIESEIRFRDNSQLLSIC 181

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKL LD LV F
Sbjct: 182 QRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLNLDQLVKF 241

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA+T EGA++LQIIGR+RCNV+ISGGTGSGKTTLLNCLTRYID DER++TCEDTAELQLQ
Sbjct: 242 GAITPEGAQVLQIIGRVRCNVVISGGTGSGKTTLLNCLTRYIDADERVITCEDTAELQLQ 301

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRG EV DLLQAMNTGHDG
Sbjct: 302 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGSEVFDLLQAMNTGHDG 361

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SMGTIHAN  RE   RME+MIAMGG++LP++ VREII+ S+D+I+Q  RLRDG+RRIT+I
Sbjct: 362 SMGTIHANTPRECLSRMESMIAMGGYSLPAKTVREIISGSIDIIIQAARLRDGTRRITHI 421

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
            E+VGMEG+VIITQDL+++E+ GED TGK+IG+HISTG+ +P FW RA  Y EE+ LA  
Sbjct: 422 TEVVGMEGDVIITQDLMRFEMDGEDLTGKIIGRHISTGIGKPHFWERARYYNEERRLAAA 481

Query: 473 LQSLEKQS 480
           L ++E+++
Sbjct: 482 LDAMEQKT 489


>gi|27376547|ref|NP_768076.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
 gi|27349688|dbj|BAC46701.1| pilus assembly protein [Bradyrhizobium japonicum USDA 110]
          Length = 487

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/416 (72%), Positives = 364/416 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YYEVK+TIF  LIE ID+ QL++ DS+SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 59  RSDNYYEVKATIFGALIEAIDLAQLAKLDSESAREEIRDIVNEIIAIKNIVMSIAEQEEL 118

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDIADIMVNG+N V+IEV GK   TGI FRDN+QLL++CQ
Sbjct: 119 LDDICNDVLGYGPLEPLLSRDDIADIMVNGANTVYIEVGGKIQRTGIRFRDNQQLLNICQ 178

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPL++DGP LTIRKFKKDKLTLD LV FG
Sbjct: 179 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLSIDGPALTIRKFKKDKLTLDQLVKFG 238

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA +LQIIGR+RCNVLISGGTGSGKTTLLNCLT YI+ DERI+TCED AELQLQQ
Sbjct: 239 AISPEGAEILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIEHDERIITCEDAAELQLQQ 298

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG+ITMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 299 PHVVRLETRPPNIEGEGQITMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 358

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DVIVQ  RLRDGSRRIT+I 
Sbjct: 359 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVIVQAARLRDGSRRITHIT 418

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNL 469
           E++GMEG+ IITQD+  Y+++GED  GK+IG+H STG+ RP+FW RA  YG+EK L
Sbjct: 419 EVMGMEGDTIITQDIFLYDMIGEDANGKIIGRHRSTGIGRPKFWERARYYGDEKRL 474


>gi|148258238|ref|YP_001242823.1| putative secretory protein kinase, cpaF-like gene [Bradyrhizobium
           sp. BTAi1]
 gi|146410411|gb|ABQ38917.1| putative secretory protein kinase, cpaF-like protein
           [Bradyrhizobium sp. BTAi1]
          Length = 433

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/416 (72%), Positives = 362/416 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 5   RSDNYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 64

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDIADIMVNG+  V+IEV GK   TGI FRDN+QLL++CQ
Sbjct: 65  LDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVYIEVAGKIQRTGIRFRDNQQLLNICQ 124

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 125 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 184

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA +LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 185 AISPEGAEILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDHDERIITCEDAAELQLQQ 244

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 245 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 304

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DVIVQ  RLRDGSRRIT+I 
Sbjct: 305 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVIVQAARLRDGSRRITHIT 364

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNL 469
           E++GMEG+ IITQD+  Y+++GED  GK+IG+H STG+ RPRFW RA  YGEEK L
Sbjct: 365 EVMGMEGDTIITQDIFLYDMIGEDANGKIIGRHRSTGIGRPRFWERARYYGEEKRL 420


>gi|115525752|ref|YP_782663.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisA53]
 gi|115519699|gb|ABJ07683.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisA53]
          Length = 489

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/424 (70%), Positives = 365/424 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 61  RSDNYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 120

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  VFIEV G+   TGI FRDN+QLL++CQ
Sbjct: 121 LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVFIEVAGRIQRTGIRFRDNQQLLNICQ 180

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 181 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 240

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ +GA +LQIIGR+RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 241 AISPDGATILQIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 300

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 301 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 360

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 361 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVIIQAARLRDGSRRITHIT 420

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+ IITQDL  Y+++GED+ G +IG+H STG+ RPRFW RA  Y EEK LA  L
Sbjct: 421 EVMGMEGDTIITQDLFLYDMVGEDQNGHIIGRHRSTGIGRPRFWERARYYNEEKRLAAAL 480

Query: 474 QSLE 477
            + E
Sbjct: 481 DAAE 484


>gi|254473788|ref|ZP_05087183.1| secretory protein kinase, CpaF [Pseudovibrio sp. JE062]
 gi|211957174|gb|EEA92379.1| secretory protein kinase, CpaF [Pseudovibrio sp. JE062]
          Length = 493

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/484 (65%), Positives = 382/484 (78%), Gaps = 9/484 (1%)

Query: 1   MFGRRDKKLMGSVKREDN--NPLPQE-----VVVSSSNIQK--QNLQSSSPSAEGEIGNF 51
           MFGRR     G+ K +    NP  Q      VV  + N  K  Q +    P    E    
Sbjct: 1   MFGRRGNGEFGNKKPKSAPVNPAVQAQATKPVVQETPNKIKPAQPVVEKQPDKPKESAPE 60

Query: 52  VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
             RT  YY  K++IF  L+E ID++QLS+ +   ARDEI  ++N+I+++K + MS+ EQ 
Sbjct: 61  NKRTQEYYATKASIFNALVEAIDLSQLSRLEQDDARDEIRDVVNDIIALKNLVMSIAEQE 120

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           DL ED+CND+LGYGPL+PL+ARDDIADIMVNG+N V+IE +G   +TGI FRDN QL+++
Sbjct: 121 DLLEDICNDVLGYGPLEPLLARDDIADIMVNGANTVYIETDGMVEQTGIQFRDNRQLMNI 180

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
           CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL+LDGP LTIRKFKKDKLTLD LV+
Sbjct: 181 CQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSLDGPALTIRKFKKDKLTLDQLVN 240

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG+++ EGA +L+IIGR+RCN +ISGGTGSGKTTLLNCLTRYID  ERI+TCED+AELQL
Sbjct: 241 FGSISPEGAEILEIIGRVRCNTVISGGTGSGKTTLLNCLTRYIDSTERIITCEDSAELQL 300

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVVRLETRPPN+EGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHD
Sbjct: 301 QQPHVVRLETRPPNLEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHD 360

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSMGTIH+N+ RE   R+E+MIA+GGF+LPS+ VREII  S+DVIVQ  RLRDGSRRIT+
Sbjct: 361 GSMGTIHSNSPRECLKRIESMIALGGFSLPSKTVREIIVGSIDVIVQAARLRDGSRRITH 420

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
           I E+VGMEG+VI TQDL  Y++ GED  GK++GQH STG+ RP FW+RA  + EE+ LA 
Sbjct: 421 ITEVVGMEGDVITTQDLFTYDITGEDANGKIVGQHRSTGIGRPLFWDRARYFNEEERLAR 480

Query: 472 VLQS 475
            L +
Sbjct: 481 ALDA 484


>gi|75674496|ref|YP_316917.1| type II secretion system protein E [Nitrobacter winogradskyi
           Nb-255]
 gi|74419366|gb|ABA03565.1| type II secretion system protein E [Nitrobacter winogradskyi
           Nb-255]
          Length = 488

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/424 (71%), Positives = 360/424 (84%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 60  RSDTYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 119

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDIADIMVNG+  VFIEV GK   TGI FRDN+QLL++CQ
Sbjct: 120 LDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVFIEVAGKIQRTGIRFRDNQQLLNICQ 179

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 180 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVRFG 239

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EG  +LQIIGR R NVLISGGTGSGKTTLLNC+T YID DERI+TCED AELQLQQ
Sbjct: 240 AITPEGGTILQIIGRCRANVLISGGTGSGKTTLLNCITNYIDHDERIITCEDAAELQLQQ 299

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG+ITMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 300 PHVVRLETRPPNIEGEGQITMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 359

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+D+I+Q  RLRDGSRRIT+I 
Sbjct: 360 MGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDIIIQAARLRDGSRRITHIT 419

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+ IITQD+  Y+++GED  G +IG+H STG+ RPRFW RA  YGEEK LA  L
Sbjct: 420 ELMGMEGDTIITQDIFVYDLLGEDANGNVIGRHRSTGIGRPRFWERARYYGEEKRLAAAL 479

Query: 474 QSLE 477
            + E
Sbjct: 480 DAAE 483


>gi|319785605|ref|YP_004145081.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171493|gb|ADV15031.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 499

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/427 (69%), Positives = 372/427 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  YY+ KS +F+ LI+ ID++QLS+ D +SAR+EI  ++N+I+++K   M++ EQ +L
Sbjct: 72  KSETYYDTKSQVFSALIDTIDLSQLSKLDPESAREEIRDIVNDIIAIKNFAMTIAEQEEL 131

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNGS  V+IEVNGK  +TGI FRDN+QLL++CQ
Sbjct: 132 LEDICNDVLGYGPLEPLLARDDIADIMVNGSRNVYIEVNGKVEQTGIRFRDNQQLLNICQ 191

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DG TLTIRKFKKDKLTLD LV FG
Sbjct: 192 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGATLTIRKFKKDKLTLDQLVKFG 251

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ +GA +L+II R+RCN++ISGGTGSGKTTLLNCLT YID++ER++TCED+AELQLQQ
Sbjct: 252 AISPQGAEVLKIISRVRCNIVISGGTGSGKTTLLNCLTNYIDREERVITCEDSAELQLQQ 311

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 312 PHVVRLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 371

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIH+N+ RE   R+E+MIAMGG++LP + VREI+  S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 372 MGTIHSNSPRECLNRIESMIAMGGYSLPQKTVREIVVGSIDVIIQAARLRDGSRRITHIT 431

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQD++ Y + GED  G+L+G+H+STG+ RP FW RA  YGEE+ LA  L
Sbjct: 432 EVIGMEGDVIITQDIVLYNIKGEDANGRLLGEHVSTGIGRPHFWERARYYGEEQRLAIAL 491

Query: 474 QSLEKQS 480
           +++EK++
Sbjct: 492 EAMEKRA 498


>gi|90419767|ref|ZP_01227676.1| Flp pilus assembly protein, kinase CpaF [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335808|gb|EAS49556.1| Flp pilus assembly protein, kinase CpaF [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 497

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/422 (71%), Positives = 363/422 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   YY  K+ +F  LI+ ID++QL++ D++SAR+EI  ++N+IV++K   MS+ EQ D+
Sbjct: 66  RPDSYYARKAEVFAALIDTIDLSQLARLDAESAREEIRDIVNDIVAIKSFAMSISEQEDM 125

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GK +ET + FRDN+QLL++CQ
Sbjct: 126 LSDICNDVLGYGPLEPLLARDDIADIMVNGARQTFIEVAGKVLETNVRFRDNQQLLNICQ 185

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPL++DG TLTIRKFKKDKLTLD LV FG
Sbjct: 186 RIVSQVGRRVDETSPICDARLPDGSRVNVIAPPLSIDGTTLTIRKFKKDKLTLDQLVQFG 245

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIGR+RCNV+ISGGTGSGKTTLLNCLTRYID DERI+TCED+AELQLQQ
Sbjct: 246 AISPEGAQILQIIGRVRCNVVISGGTGSGKTTLLNCLTRYIDTDERIITCEDSAELQLQQ 305

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 306 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 365

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIHAN+ RE   RME+MIAMGGF+LPS+ V+EII  S+DVIVQ  RLRDGSRRIT+I 
Sbjct: 366 MGTIHANSPRECLNRMESMIAMGGFSLPSRTVKEIIVGSIDVIVQAARLRDGSRRITHIT 425

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VI TQDL  Y++ GED  G++IG+H STG+ RP FW+RA  Y EE+ LA  L
Sbjct: 426 EVLGMEGDVITTQDLFVYDMTGEDAQGRIIGRHRSTGIGRPAFWDRARYYNEEQRLAAAL 485

Query: 474 QS 475
            +
Sbjct: 486 DA 487


>gi|227823974|ref|YP_002827947.1| pilus assembly protein ATPase CpaF [Sinorhizobium fredii NGR234]
 gi|227342976|gb|ACP27194.1| pilus assembly protein ATPase CpaF [Sinorhizobium fredii NGR234]
          Length = 465

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/421 (71%), Positives = 364/421 (86%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           YY+ KS +F+ LI+ ID++QL++ D++SAR+EI  ++N+I+++K   MS+ EQ +L +D+
Sbjct: 44  YYDTKSQVFSALIDTIDLSQLAKLDTESAREEIRDIVNDIITIKNFAMSIAEQEELLDDI 103

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
           CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GK  E+ + FRDN QLLS+CQRIV+
Sbjct: 104 CNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKVEESDVRFRDNAQLLSICQRIVS 163

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTL+ LV FG++T 
Sbjct: 164 QVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLEQLVRFGSITP 223

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
            GA LLQIIGR+RCN++ISGGTGSGKTTLLNCLTRYID DERI+TCED+AELQLQQPHVV
Sbjct: 224 AGATLLQIIGRVRCNIVISGGTGSGKTTLLNCLTRYIDIDERIITCEDSAELQLQQPHVV 283

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEGEG+ITMRDL+KNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGSMGTI
Sbjct: 284 RLETRPPNIEGEGQITMRDLIKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGSMGTI 343

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  RE   RME+MIAMGG+TLP++ VREII  S+DVI+Q  RLRDGSRRIT++ E+ G
Sbjct: 344 HANTPRECLSRMESMIAMGGYTLPAKTVREIIAGSVDVIIQASRLRDGSRRITHVTEVTG 403

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           MEG+VI+TQDL++YE+ GED  G++IG+H+STG+ RP FW+RA  + E K LA  L ++E
Sbjct: 404 MEGDVIVTQDLMRYEIDGEDANGRIIGRHVSTGIGRPHFWDRARYFNEHKRLAATLDAME 463

Query: 478 K 478
           K
Sbjct: 464 K 464


>gi|85713508|ref|ZP_01044498.1| type II secretion system protein E [Nitrobacter sp. Nb-311A]
 gi|85699412|gb|EAQ37279.1| type II secretion system protein E [Nitrobacter sp. Nb-311A]
          Length = 488

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/484 (64%), Positives = 379/484 (78%), Gaps = 8/484 (1%)

Query: 1   MFGRRD------KKLMGSVKREDNNPLPQEVV-VSSSNIQKQNLQSSSPSAEGEIGNFVN 53
           MFG+R       +KL G  +        Q    V+S  +    L  + P+ +    +   
Sbjct: 1   MFGKRSGPEDSTRKLAGLTEVAPPTSNTQTSTEVASPKVASPPLAPARPATQTPAID-AR 59

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 60  RSDTYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSIAEQEEL 119

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDIADIMVNG+  VFIEV GK   TGI FRDN+QLL++CQ
Sbjct: 120 LDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVFIEVAGKIQRTGIRFRDNQQLLNICQ 179

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 180 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 239

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EG  +LQIIGR R NVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 240 AITPEGGTILQIIGRCRANVLISGGTGSGKTTLLNCLTNYIDHDERIITCEDAAELQLQQ 299

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 300 PHVVRLETRPPNIEGEGQVTMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 359

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+D+I+Q  RLRDGSRRIT+I 
Sbjct: 360 MGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDIIIQAARLRDGSRRITHIT 419

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG  IITQD+  Y+++GED  G +IG+H STG+ RPRFW RA  Y EEK LA  L
Sbjct: 420 ELMGMEGETIITQDIFLYDLIGEDANGNVIGRHRSTGIGRPRFWERARYYNEEKRLAAAL 479

Query: 474 QSLE 477
            + E
Sbjct: 480 DAAE 483


>gi|91977988|ref|YP_570647.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisB5]
 gi|91684444|gb|ABE40746.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisB5]
          Length = 482

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/424 (70%), Positives = 365/424 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY+VK+TIF  LIE ID+ QL++ D++SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 54  RSDVYYQVKATIFGALIEAIDLAQLAKLDAESAREEIRDIVNEIIAIKNIVMSIAEQEEL 113

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNGS  V+IEV G+   TGI FRDN+QLL++CQ
Sbjct: 114 LDDICNDVLGYGPLEPLLSRDDISDIMVNGSGTVYIEVAGRIQRTGIRFRDNQQLLNICQ 173

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 174 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 233

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA++LQIIGR R NVLISGGTGSGKTTLLNCLT+YID DERI+TCED AELQLQQ
Sbjct: 234 AITPEGAQILQIIGRCRANVLISGGTGSGKTTLLNCLTQYIDDDERIITCEDAAELQLQQ 293

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 294 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 353

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DV++Q  RLRDGSRRIT+I 
Sbjct: 354 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVVIQAARLRDGSRRITHIT 413

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+ IITQDL  Y+++GED  G +IG+H STG+ RP+FW RA  YGEEK LA  L
Sbjct: 414 EVIGMEGDTIITQDLFIYDMVGEDVNGNIIGRHRSTGIGRPKFWERARYYGEEKRLAAAL 473

Query: 474 QSLE 477
            + E
Sbjct: 474 DAAE 477


>gi|86748904|ref|YP_485400.1| type II secretion system protein E [Rhodopseudomonas palustris
           HaA2]
 gi|86571932|gb|ABD06489.1| type II secretion system protein E [Rhodopseudomonas palustris
           HaA2]
          Length = 467

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/414 (72%), Positives = 361/414 (87%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+ +YY+VK+TIF  LIE ID+ QL++ D++SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 39  RSDNYYQVKATIFGALIEAIDLAQLAKLDAESAREEIRDIVNEIIAIKNIVMSISEQEEL 98

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  VFIEV G+   TGI FRDN+QLL++CQ
Sbjct: 99  LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVFIEVAGRIQRTGIRFRDNQQLLNICQ 158

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 159 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 218

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA++LQIIGR RCNVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 219 AITPEGAQILQIIGRTRCNVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 278

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 279 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 338

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 339 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVIIQAARLRDGSRRITHIT 398

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+ IITQDL  Y+++GED  G ++G+H STG+ RPRFW RA  YGEEK
Sbjct: 399 EVMGMEGDTIITQDLFIYDIIGEDANGHIVGRHRSTGIGRPRFWERARYYGEEK 452


>gi|114705452|ref|ZP_01438360.1| secretory protein kinase, cpaF [Fulvimarina pelagi HTCC2506]
 gi|114540237|gb|EAU43357.1| secretory protein kinase, cpaF [Fulvimarina pelagi HTCC2506]
          Length = 504

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/435 (69%), Positives = 366/435 (84%), Gaps = 6/435 (1%)

Query: 41  SPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSV 100
           +P A G+      R   +YE KS +F  LI+ ID++QL+  D ++AR+EI  ++N+I+++
Sbjct: 66  TPRASGK------RDEAFYERKSQVFAALIDTIDLSQLAGMDIEAAREEIRDIVNDIIAI 119

Query: 101 KKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGI 160
           K   M++ EQ D+  D+CND+LGYGPL+PL+ RDDIADIMVNG+ + FIEVNGKT+ET +
Sbjct: 120 KNYAMTIAEQEDMLADICNDVLGYGPLEPLLMRDDIADIMVNGAKQTFIEVNGKTIETNV 179

Query: 161 NFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFK 220
            FRDN+QLL++CQRIV+QVGRRVDE+SPICDARL DGSRVNVI PPLALDG  LTIRKFK
Sbjct: 180 QFRDNQQLLNICQRIVSQVGRRVDETSPICDARLPDGSRVNVIAPPLALDGAALTIRKFK 239

Query: 221 KDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERI 280
           KDKLTLD LV FG++T EGA +LQIIGR+RCN++ISGGTGSGKTTLLNC+T YID  ERI
Sbjct: 240 KDKLTLDQLVKFGSITPEGAEILQIIGRVRCNIVISGGTGSGKTTLLNCMTHYIDSHERI 299

Query: 281 VTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVL 340
           VTCED+AELQLQQPHVVRLETRPPNIEGEG ITMRDLVKNCLRMRPERI++GEVRGPEV 
Sbjct: 300 VTCEDSAELQLQQPHVVRLETRPPNIEGEGAITMRDLVKNCLRMRPERIVVGEVRGPEVF 359

Query: 341 DLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQ 400
           DLLQAMNTGHDGSMGTIHAN+ RE   R+E+MIAMGG++LPS+ V+EII  S+DVIVQ  
Sbjct: 360 DLLQAMNTGHDGSMGTIHANSPRECLNRIESMIAMGGYSLPSRTVKEIICGSVDVIVQAA 419

Query: 401 RLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRA 460
           RLRDGSRRIT++ E+VGMEG+VIITQDL  YE+ GED  G+LIG+H STG+ RP+FW++A
Sbjct: 420 RLRDGSRRITHVTEVVGMEGDVIITQDLFVYEIQGEDANGRLIGKHRSTGIGRPKFWDKA 479

Query: 461 AQYGEEKNLAEVLQS 475
             YGEEK LA  L +
Sbjct: 480 RYYGEEKRLATALDA 494


>gi|150377237|ref|YP_001313832.1| type II secretion system protein E [Sinorhizobium medicae WSM419]
 gi|150031784|gb|ABR63899.1| type II secretion system protein E [Sinorhizobium medicae WSM419]
          Length = 477

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 379/482 (78%), Gaps = 6/482 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE 60
           MFG++        +++ +    Q V+ +        +Q   P+       F ++   YY 
Sbjct: 2   MFGKKSIS-----EKQISEAAVQSVIENEPQAAPALVQVLKPTQVAATARF-DKAEQYYS 55

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  IF+ LI  ID+  LS  D + AR EI  ++N+IV+ KK  +S+ EQ +L  D+CND
Sbjct: 56  LKKEIFSALIATIDVAALSNMDVEQARGEIGAIINDIVAAKKAGISMAEQNNLLSDICND 115

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ILGYGPL+PL+ARDDIADIMVNG+N+VFIEVNG+  ETG+ FRDNEQLL++CQRIV+QVG
Sbjct: 116 ILGYGPLEPLLARDDIADIMVNGANQVFIEVNGRVQETGVRFRDNEQLLNICQRIVSQVG 175

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDESSPICDARL DGSRVNVI PPLA+DGPTLTIRKFKK+KLTLD LV FG+++ EGA
Sbjct: 176 RRVDESSPICDARLADGSRVNVIAPPLAIDGPTLTIRKFKKEKLTLDQLVRFGSISQEGA 235

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
            +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID  ER++TCED AELQLQQPHVVRLE
Sbjct: 236 EVLKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDHGERVITCEDAAELQLQQPHVVRLE 295

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPNIEG+GEITMR LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT+HAN
Sbjct: 296 TRPPNIEGQGEITMRSLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTLHAN 355

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           + RE+  R+EAMI MGG +LP++ +RE++ SS+DVIVQ  RLRDGSRRIT+I E++GMEG
Sbjct: 356 SPREAMARVEAMITMGGSSLPARTIREMLVSSVDVIVQAARLRDGSRRITHITEVLGMEG 415

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQS 480
           +VI TQDL  Y+++GEDE G +IG+H STG+ RP FW+RA  YGEE  LA  L + E ++
Sbjct: 416 DVITTQDLFIYDILGEDEKGNIIGRHRSTGIGRPAFWDRARYYGEEGRLAAALDAAEMKA 475

Query: 481 RA 482
            A
Sbjct: 476 AA 477


>gi|299132289|ref|ZP_07025484.1| type II secretion system protein E [Afipia sp. 1NLS2]
 gi|298592426|gb|EFI52626.1| type II secretion system protein E [Afipia sp. 1NLS2]
          Length = 488

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/418 (72%), Positives = 363/418 (86%)

Query: 50  NFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDE 109
           N   R+  YY+VK+TIF  LIE ID+ QL++ D++SAR+EI  ++NEI+++K I MS+ E
Sbjct: 55  NESRRSESYYQVKATIFGALIEAIDLAQLAKLDAESAREEIRDIVNEIIAIKNIVMSIAE 114

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           Q +L +D+CND+LGYGPL+PL+ARDDIADIMVNG+  VFIEV GK  +TGI FRDN+QLL
Sbjct: 115 QEELLDDICNDVLGYGPLEPLLARDDIADIMVNGAGTVFIEVAGKIQKTGIRFRDNQQLL 174

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
           ++CQRIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD L
Sbjct: 175 NICQRIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQL 234

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           V+FGA++ EGA++LQIIGR R NVLISGGTGSGKTTLLNCLT YID+DERI+TCED AEL
Sbjct: 235 VNFGAISPEGAQILQIIGRCRANVLISGGTGSGKTTLLNCLTNYIDEDERIITCEDAAEL 294

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QLQQPHVVRLETRPPNIEGEG++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTG
Sbjct: 295 QLQQPHVVRLETRPPNIEGEGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTG 354

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGSMGT+HANN RE+  R E+MI MGG++LPS+ +RE++ +S+DVIVQ  RLRDGSRRI
Sbjct: 355 HDGSMGTLHANNPREALSRCESMITMGGYSLPSRTIREMMCASIDVIVQAARLRDGSRRI 414

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           T++ E++GMEG+ IITQD+  Y++ GED  G +IG+H STG+ RPRFW+RA  YGEEK
Sbjct: 415 THVTEVMGMEGDTIITQDIFVYDITGEDINGNIIGRHRSTGIGRPRFWDRARYYGEEK 472


>gi|328545276|ref|YP_004305385.1| secretory protein kinase, cpaF-like gene [polymorphum gilvum
           SL003B-26A1]
 gi|326415018|gb|ADZ72081.1| Putative secretory protein kinase, cpaF-like gene [Polymorphum
           gilvum SL003B-26A1]
          Length = 469

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/414 (71%), Positives = 360/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+P YYE KS+IF  L+E ID++QLS+   + ARDEI  ++N+I+++K + MS+ EQ DL
Sbjct: 39  RSPEYYETKSSIFNALVEAIDLSQLSRLGPEDARDEIRDVVNDIIALKNVVMSISEQEDL 98

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNG++ V+IE  GK  +T I FRDN QL+++CQ
Sbjct: 99  LEDICNDVLGYGPLEPLLARDDIADIMVNGAHTVYIETEGKMQQTNIAFRDNAQLMNICQ 158

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 159 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVKFG 218

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           ++T EGA +LQIIGR RCNVL+SGGTGSGKTTLLNCLT YID  ERI+TCED+AELQLQQ
Sbjct: 219 SITPEGATILQIIGRSRCNVLVSGGTGSGKTTLLNCLTAYIDTTERIITCEDSAELQLQQ 278

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 279 PHVVRLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 338

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE+  R+E+MI MGGF+LPS+ +RE+I SS+DVIVQ  RLRDGSRRIT+I 
Sbjct: 339 MGTLHANSPREALSRVESMITMGGFSLPSKTLREMIVSSIDVIVQAARLRDGSRRITHIT 398

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+VIITQD+  Y+++GED +G++IG+H STG+ RP+FW RA  +GEE+
Sbjct: 399 EVMGMEGDVIITQDIFLYDIIGEDASGRIIGRHRSTGIGRPKFWERARYFGEEQ 452


>gi|209886533|ref|YP_002290390.1| CpaF [Oligotropha carboxidovorans OM5]
 gi|209874729|gb|ACI94525.1| CpaF [Oligotropha carboxidovorans OM5]
          Length = 489

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/418 (72%), Positives = 363/418 (86%)

Query: 50  NFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDE 109
           N   R+ +YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+ E
Sbjct: 56  NDSRRSDNYYQVKATIFGALIEAIDLAQLAKLDVESAREEIRDIVNEIIAIKNIVMSIAE 115

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           Q +L +D+CND+LGYGPL+PL+ARDDIADIMVNGS+ VFIEV GK  +TGI FRDN+QLL
Sbjct: 116 QEELLDDICNDVLGYGPLEPLLARDDIADIMVNGSDTVFIEVAGKIQKTGIRFRDNQQLL 175

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
           ++CQRIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFK+DKLTLD L
Sbjct: 176 NICQRIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKRDKLTLDQL 235

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           V FGA++ EGA++LQIIGR R NVLISGGTGSGKTTLLNCLT YID+DERI+TCED AEL
Sbjct: 236 VQFGAISPEGAQILQIIGRCRANVLISGGTGSGKTTLLNCLTNYIDEDERIITCEDAAEL 295

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QLQQPHVVRLETRPPNIEGEG++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTG
Sbjct: 296 QLQQPHVVRLETRPPNIEGEGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTG 355

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGSMGT+HANN RE+  R E+MI MGG+ LPS+ +RE++ +S+DVIVQ  RLRDGSRRI
Sbjct: 356 HDGSMGTLHANNPREALSRCESMITMGGYALPSRTIREMMCASIDVIVQAARLRDGSRRI 415

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           T+I E++GMEG+ IITQD+  Y+++GED  G ++G+H STG+ RPRFW+RA  YGEEK
Sbjct: 416 THITEVMGMEGDTIITQDIFVYDILGEDINGNILGRHRSTGIGRPRFWDRARYYGEEK 473


>gi|92116010|ref|YP_575739.1| type II secretion system protein E [Nitrobacter hamburgensis X14]
 gi|91798904|gb|ABE61279.1| type II secretion system protein E [Nitrobacter hamburgensis X14]
          Length = 489

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 381/490 (77%), Gaps = 19/490 (3%)

Query: 1   MFGRR-----DKKLMGSVKRE-----DNNPLPQEVV---VSSSNIQKQNLQSSSPSAEGE 47
           MFG+R     D + M  +  E      N   P E+    V+S  +        +P+ +  
Sbjct: 1   MFGKRSGPEDDARKMAGLTLEATPAIQNVRAPAEIASPTVASPPLAPARSAPHTPAIDAR 60

Query: 48  IGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSL 107
                 R+  YY+VK+TIF  LIE ID+ QL++ D +SAR+EI  ++NEI+++K I MS+
Sbjct: 61  ------RSETYYQVKATIFGALIEAIDLAQLAKLDGESAREEIRDIVNEIIAIKNIVMSI 114

Query: 108 DEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQ 167
            EQ +L +D+CND+LGYGPL+PL++RDDIADIMVNG+  VFIEV GK   TGI FRDN+Q
Sbjct: 115 AEQEELLDDICNDVLGYGPLEPLLSRDDIADIMVNGAGTVFIEVAGKIQRTGIRFRDNQQ 174

Query: 168 LLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLD 227
           LL++CQRIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKF+KDKLTLD
Sbjct: 175 LLNICQRIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFRKDKLTLD 234

Query: 228 HLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA 287
            LV FGA+T EG  +LQIIGR R NVLISGGTGSGKTTLLNCLT YID DERI+TCED A
Sbjct: 235 QLVKFGAITPEGGTILQIIGRCRANVLISGGTGSGKTTLLNCLTNYIDHDERIITCEDAA 294

Query: 288 ELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMN 347
           ELQLQQPHVVRLETRPPNIEGEG+++MR+LV+NCLRMRPERII+GEVRGPE  DLLQAMN
Sbjct: 295 ELQLQQPHVVRLETRPPNIEGEGQVSMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMN 354

Query: 348 TGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSR 407
           TGHDGSMGT+HANN RE+  R E+MI MGGF LPS+ +RE+I +S+D+I+Q  RLRDGSR
Sbjct: 355 TGHDGSMGTLHANNPREALSRCESMITMGGFALPSRTIREMICASIDIIIQAARLRDGSR 414

Query: 408 RITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           RIT+I E++GMEG+ IITQD+  Y+++GED  G ++G+H STG+ RPRFW RA  Y EEK
Sbjct: 415 RITHITEVMGMEGDTIITQDIFIYDLLGEDANGNVVGRHRSTGIGRPRFWERARYYNEEK 474

Query: 468 NLAEVLQSLE 477
            LA  L + E
Sbjct: 475 RLAAALDAAE 484


>gi|260461946|ref|ZP_05810191.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
 gi|259032193|gb|EEW33459.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
          Length = 501

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/427 (68%), Positives = 370/427 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  YY+ KS +F+ LI+ ID++QL++ D +SAR+EI  ++N+I+++K   MS+ EQ +L
Sbjct: 74  KSETYYDTKSQVFSALIDTIDLSQLAKLDPESAREEIRDIVNDIIAIKNFAMSIAEQEEL 133

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ARDDIADIMVNGS  V+IEVNGK  +T I FRDN+QLL++CQ
Sbjct: 134 LEDICNDVLGYGPLEPLLARDDIADIMVNGSKNVYIEVNGKVEQTPIRFRDNQQLLNICQ 193

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DG  LTIRKFKKDKLTLD LV FG
Sbjct: 194 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGTALTIRKFKKDKLTLDQLVKFG 253

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ +GA +L+II R+RCN++ISGGTGSGKTTLLNCLT YID++ER++TCED+AELQLQQ
Sbjct: 254 AISPQGAEVLKIISRVRCNIVISGGTGSGKTTLLNCLTNYIDREERVITCEDSAELQLQQ 313

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRGPEV DLLQAMNTGHDGS
Sbjct: 314 PHVVRLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGS 373

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIH+N+ RE   R+E+MIAMGG++LP + VREI+  S+DVI+Q  RLRDGSRRIT+I 
Sbjct: 374 MGTIHSNSPRECLNRIESMIAMGGYSLPQKTVREIVVGSIDVIIQAARLRDGSRRITHIT 433

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+V+ITQD++ Y + GED  G+L+G+H+STG+ RP FW RA  YGEE+ LA  L
Sbjct: 434 EVIGMEGDVVITQDIVLYNIKGEDANGRLLGEHVSTGIGRPHFWERARYYGEEQRLAIAL 493

Query: 474 QSLEKQS 480
           +++EK++
Sbjct: 494 EAMEKRA 500


>gi|239833234|ref|ZP_04681563.1| type II secretion system protein E [Ochrobactrum intermedium LMG
           3301]
 gi|239825501|gb|EEQ97069.1| type II secretion system protein E [Ochrobactrum intermedium LMG
           3301]
          Length = 502

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/442 (68%), Positives = 367/442 (83%)

Query: 39  SSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV 98
           S  P  +   G+   +T  YY+ KS +F+ LI+ ID++QLS+    +AR+EI  ++N+I+
Sbjct: 60  SHQPGTQQSSGHGREKTESYYDTKSQVFSALIDTIDLSQLSRMAPDAAREEIRDIVNDII 119

Query: 99  SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVET 158
           ++K   MS+ EQ +L +D+CND+LGYGPL+PL++RDDIADIMVNGS + +IEV+G   ET
Sbjct: 120 AIKNFVMSIAEQEELLDDICNDVLGYGPLEPLLSRDDIADIMVNGSRRTYIEVDGLLQET 179

Query: 159 GINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRK 218
           GI FRDN+QLL++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL+LDGPTLTIRK
Sbjct: 180 GIRFRDNQQLLNICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSLDGPTLTIRK 239

Query: 219 FKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDE 278
           F+KDKLTLD LV FGA++  GA LLQII R+RCNV+ISGGTGSGKTTLLNCLTRYID  E
Sbjct: 240 FRKDKLTLDQLVRFGAISNAGAELLQIISRVRCNVIISGGTGSGKTTLLNCLTRYIDAHE 299

Query: 279 RIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPE 338
           RI+TCED+AELQLQQPHVVRLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRGPE
Sbjct: 300 RIITCEDSAELQLQQPHVVRLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGPE 359

Query: 339 VLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQ 398
           V DLLQAMNTGHDGSMGTIHAN+ RE   RMEAMIAMGG+ LP + VREII  S+D+I+Q
Sbjct: 360 VFDLLQAMNTGHDGSMGTIHANSPRECLNRMEAMIAMGGYVLPQKTVREIIVGSVDIIIQ 419

Query: 399 TQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWN 458
             RLRDGSRRIT+I E+VG+EG+VI TQDL+ Y++ GED +G+++G H STG+ RP FW 
Sbjct: 420 AARLRDGSRRITHITEVVGLEGDVITTQDLVLYDIKGEDASGRILGSHSSTGIGRPAFWE 479

Query: 459 RAAQYGEEKNLAEVLQSLEKQS 480
           RA  Y E+  LA VL  +E+ S
Sbjct: 480 RARYYNEDSRLASVLDGMERAS 501


>gi|110632961|ref|YP_673169.1| type II secretion system protein E [Mesorhizobium sp. BNC1]
 gi|110283945|gb|ABG62004.1| type II secretion system protein E [Chelativorans sp. BNC1]
          Length = 476

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/433 (69%), Positives = 362/433 (83%), Gaps = 5/433 (1%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT 92
           Q + L +++P+A     +F  +   YYE+K  +F+ LI  ID+  LS  +   AR EI  
Sbjct: 32  QSEKLPATAPAA-----SFAEKPSSYYELKKEVFSALIAAIDVAALSVMEQSQARKEIGA 86

Query: 93  LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVN 152
           ++N+IV+ K+  +S  EQ DL  D+C+DILGYGPL+PL+ARDDIADIMVNG+N+VFIEV 
Sbjct: 87  IINDIVAAKRAGISQAEQNDLLRDICDDILGYGPLEPLLARDDIADIMVNGANQVFIEVG 146

Query: 153 GKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGP 212
           G+  E+GI FRDNEQLL++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP
Sbjct: 147 GQVQESGIRFRDNEQLLNICQRIVSQVGRRVDESSPICDARLADGSRVNVIAPPLAIDGP 206

Query: 213 TLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTR 272
            LTIRKF+KDKLTLD LV+FG++T EGA LL+IIGR+RCNVLISGGTGSGKTTLLNCLT 
Sbjct: 207 ALTIRKFRKDKLTLDQLVTFGSITPEGAELLKIIGRVRCNVLISGGTGSGKTTLLNCLTG 266

Query: 273 YIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILG 332
           YID  ERIVTCED AELQLQQPHVVRLETRPPNIEG+GEITMR+LVKNCLRMRPERII+G
Sbjct: 267 YIDDGERIVTCEDAAELQLQQPHVVRLETRPPNIEGQGEITMRNLVKNCLRMRPERIIVG 326

Query: 333 EVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSS 392
           EVRGPE  DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI  GGFTLPS+ +RE+I SS
Sbjct: 327 EVRGPEAFDLLQAMNTGHDGSMGTLHANSPREAISRLESMITTGGFTLPSKTIREMIVSS 386

Query: 393 LDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
           +DVIVQ  RLRDGSRRIT+I E++GMEG+V+ITQDL  Y+++GED  G+LIG+H STG+ 
Sbjct: 387 VDVIVQAARLRDGSRRITHITEVLGMEGDVVITQDLFVYDILGEDANGRLIGRHRSTGIG 446

Query: 453 RPRFWNRAAQYGE 465
           RP FW+RA  YGE
Sbjct: 447 RPAFWDRARYYGE 459


>gi|118589706|ref|ZP_01547111.1| pilus assembly protein [Stappia aggregata IAM 12614]
 gi|118437792|gb|EAV44428.1| pilus assembly protein [Stappia aggregata IAM 12614]
          Length = 474

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/421 (69%), Positives = 363/421 (86%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
            YYE K+ IF  L+E ID++QL++ D++ ARDEI  ++N+I+++K + MS+ EQ DL ED
Sbjct: 47  EYYETKAQIFNALVEAIDLSQLARLDAEDARDEIRDVVNDIIALKNVVMSISEQEDLLED 106

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           +CND+LGYGPL+PL+ARDDIADIMVNG++ V+IE +GK  +TG+ FRDN QL+++CQRIV
Sbjct: 107 ICNDVLGYGPLEPLLARDDIADIMVNGAHTVYIETSGKVEQTGVAFRDNAQLMNICQRIV 166

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVD+SSPICDARL DGSRVNVI PPLA+DGP LTIRKFK+DKLTLD LV FG++T
Sbjct: 167 SQVGRRVDDSSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKRDKLTLDQLVKFGSIT 226

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGA +LQ+IGR RCNVLISGGTGSGKTTLLNCLT YI+  ERI+TCED+AELQLQQPHV
Sbjct: 227 PEGATILQVIGRSRCNVLISGGTGSGKTTLLNCLTAYIENTERIITCEDSAELQLQQPHV 286

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EGEGEITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 287 VRLETRPPNLEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 346

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGGF+LPS+ +RE+I SS+DV+VQ  RLRDGSRRIT++ E++
Sbjct: 347 LHANSPREALSRLESMITMGGFSLPSRTLREMIVSSIDVVVQAARLRDGSRRITHVTEVM 406

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           GMEG+VI TQD+  Y+++GED  GK+IG+H STG+ RP+FW RA  +GEE  LA+ L + 
Sbjct: 407 GMEGDVITTQDVFLYDIVGEDPNGKIIGRHRSTGIGRPKFWERARYFGEEARLAQALDAS 466

Query: 477 E 477
           E
Sbjct: 467 E 467


>gi|153008062|ref|YP_001369277.1| type II secretion system protein E [Ochrobactrum anthropi ATCC
           49188]
 gi|151559950|gb|ABS13448.1| type II secretion system protein E [Ochrobactrum anthropi ATCC
           49188]
          Length = 492

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 379/489 (77%), Gaps = 11/489 (2%)

Query: 1   MFGRR-----------DKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIG 49
           MFGRR            +  M         P P + VV  S +Q     + + S      
Sbjct: 1   MFGRRGNDTGNKPESGTRPAMPKPASSAAMPAPTQPVVQPSRMQAAVPSTPAKSHTQTGT 60

Query: 50  NFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDE 109
               +T  YY+ KS +F+ LI+ ID++QLS+    +AR+EI  ++N+I+++K   MS+ E
Sbjct: 61  QGREKTESYYDTKSQVFSALIDTIDLSQLSRMAPDAAREEIRDIVNDIIAIKNFVMSIAE 120

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           Q +L +D+CND+LGYGPL+PL++RDDIADIMVNGS + +IEV+G   ETGI FRDN+QLL
Sbjct: 121 QEELLDDICNDVLGYGPLEPLLSRDDIADIMVNGSRRTYIEVDGLLQETGIRFRDNQQLL 180

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
           ++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL+LDGPTLTIRKF+KDKLTLD L
Sbjct: 181 NICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSLDGPTLTIRKFRKDKLTLDQL 240

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           V FGA++  GA LLQII R+RCNV+ISGGTGSGKTTLLNCLTRYID  ERI+TCED+AEL
Sbjct: 241 VRFGAISNAGAELLQIISRVRCNVIISGGTGSGKTTLLNCLTRYIDTHERIITCEDSAEL 300

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QLQQPHVVRLETRPPN+EGEGE+TMRDLVKNCLRMRPERII+GEVRG EV DLLQAMNTG
Sbjct: 301 QLQQPHVVRLETRPPNLEGEGEVTMRDLVKNCLRMRPERIIVGEVRGSEVFDLLQAMNTG 360

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGSMGTIHAN+ RE   RMEAMIAMGG+ LP + VREII  S+D+I+Q  RLRDG+RRI
Sbjct: 361 HDGSMGTIHANSPRECLNRMEAMIAMGGYVLPQKTVREIIVGSVDIIIQAARLRDGTRRI 420

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNL 469
           T+I E+VG+EG+VI TQDL+ Y++ GED +G+++G H STG+ RP FW RA  Y E+  L
Sbjct: 421 THITEVVGLEGDVITTQDLVLYDIKGEDASGRILGNHSSTGIGRPAFWERARYYNEDNRL 480

Query: 470 AEVLQSLEK 478
           A VL S+E+
Sbjct: 481 ASVLDSMER 489


>gi|90425200|ref|YP_533570.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisB18]
 gi|90107214|gb|ABD89251.1| type II secretion system protein E [Rhodopseudomonas palustris
           BisB18]
          Length = 490

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/414 (71%), Positives = 358/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY+VK+TIF  LIE ID+ QL++ D++SAR+EI  ++NEI+++K I MS+ EQ +L
Sbjct: 62  RSDTYYQVKATIFGALIEAIDLAQLAKLDAESAREEIRDIVNEIIAIKNIVMSIAEQEEL 121

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL++RDDI+DIMVNG+  VFIEV G+   TGI FRDN+QLL++CQ
Sbjct: 122 LDDICNDVLGYGPLEPLLSRDDISDIMVNGAGTVFIEVAGRIQRTGIRFRDNQQLLNICQ 181

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVN I+PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 182 RIVSQVGRRVDESSPICDARLADGSRVNAIVPPLAIDGPALTIRKFKKDKLTLDQLVKFG 241

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T EGA +LQIIGR R NVLISGGTGSGKTTLLNCLT YID DERI+TCED AELQLQQ
Sbjct: 242 AITPEGATILQIIGRCRANVLISGGTGSGKTTLLNCLTNYIDDDERIITCEDAAELQLQQ 301

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEGEG++TMR+LV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 302 PHVVRLETRPPNIEGEGQVTMRELVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 361

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HANN RE+  R E+MI MGGF+LPS+ +RE+I +S+DV++Q  RLRDGSRRIT+I 
Sbjct: 362 MGTLHANNPREALSRCESMITMGGFSLPSRTIREMICASIDVVIQAARLRDGSRRITHIT 421

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+ IITQDL  Y+++GED  G ++G+H STG+ RPRFW RA  YGEEK
Sbjct: 422 EVMGMEGDTIITQDLFIYDMIGEDANGHIVGRHRSTGIGRPRFWERARYYGEEK 475


>gi|323137428|ref|ZP_08072506.1| type II secretion system protein E [Methylocystis sp. ATCC 49242]
 gi|322397415|gb|EFX99938.1| type II secretion system protein E [Methylocystis sp. ATCC 49242]
          Length = 482

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 379/483 (78%), Gaps = 12/483 (2%)

Query: 1   MFGRRDK------KLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNR 54
           MFG+R        K  G       +  PQ  +VS     +    S+ P+ E +      +
Sbjct: 1   MFGKRTNVGEAAAKPRGPTAPTTTSVKPQLPLVSGPAAIEPASTSAPPAPEQK------K 54

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +  YY  KS IF  LIE ID+ QLS+ D ++AR+EI  ++NEI+++K + MS+ EQ +L 
Sbjct: 55  SEEYYVTKSVIFGALIEAIDLAQLSKLDPENAREEIRDIVNEIIAIKNVVMSIAEQEELL 114

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           +D+CND+LGYGPL+PL+ARDDIADIMVNG+ K +IEV GK   T I FRDN QL+++CQR
Sbjct: 115 DDICNDVLGYGPLEPLLARDDIADIMVNGAFKTYIEVGGKIQLTNIRFRDNSQLMNICQR 174

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+QVGRRVDESSPICDARLLDGSRVNVI PPLA+DGP LTIRKFKKDKLTLD L+ FGA
Sbjct: 175 IVSQVGRRVDESSPICDARLLDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLMRFGA 234

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           ++ EG  +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YI+ DER++TCED AELQLQQP
Sbjct: 235 ISPEGGEVLKIIGRVRCNVLISGGTGSGKTTLLNCLTNYIEGDERVITCEDAAELQLQQP 294

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRPPN+EG G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSM
Sbjct: 295 HVVRLETRPPNLEGHGAVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSM 354

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
           GT+HAN+ RE+ GR+E+MI MGGF+LP++ +R++I SS+DVI+Q  RLRDGSRRIT+I E
Sbjct: 355 GTLHANSPREALGRLESMITMGGFSLPAKTIRDMIVSSIDVIIQAARLRDGSRRITHITE 414

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           ++G+EG+V+  QDL  YE++GED  GK+IG+H STG+ RPRFW RA  YGE++ LA  L 
Sbjct: 415 VMGLEGDVVTMQDLFVYEILGEDANGKIIGRHRSTGIGRPRFWERARYYGEDERLAAALD 474

Query: 475 SLE 477
           + E
Sbjct: 475 ASE 477


>gi|16263305|ref|NP_436098.1| CpaF2 pilus assembly protein [Sinorhizobium meliloti 1021]
 gi|14523984|gb|AAK65510.1| CpaF2 pilus assembly protein [Sinorhizobium meliloti 1021]
          Length = 497

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/410 (72%), Positives = 352/410 (85%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
            YY +K  IF+ LI  ID+  LS  D + AR+EI  ++N+IV+ KK  +S+ EQ DL  D
Sbjct: 72  QYYSLKKEIFSALIATIDVAALSNMDGEQARNEIGAIINDIVAAKKAGISMAEQNDLLSD 131

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           +CNDILGYGPL+PL+ARDDIADIMVNG+N+VFIEVNG+  ETGI FRDNEQLL++CQRIV
Sbjct: 132 ICNDILGYGPLEPLLARDDIADIMVNGANQVFIEVNGRVQETGIRFRDNEQLLNICQRIV 191

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLA+DGPTLTIRKFKK+KLTLD LV FG+++
Sbjct: 192 SQVGRRVDESSPICDARLGDGSRVNVIAPPLAIDGPTLTIRKFKKEKLTLDQLVRFGSIS 251

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGA +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID  ER++TCED AELQLQQPHV
Sbjct: 252 PEGAEVLKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDHGERVITCEDAAELQLQQPHV 311

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPNIEG+GEITMR+LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 312 VRLETRPPNIEGQGEITMRNLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 371

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+EAMI MGG +LP++ +RE++ SS+DVIVQ  RLRDGSRRIT+I E++
Sbjct: 372 LHANSPREAMARIEAMITMGGSSLPAKTIREMLVSSVDVIVQAARLRDGSRRITHITEVL 431

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           GMEG V+ TQDL  Y+++GEDE G +IG+H STG+ RP FW+RA  YGEE
Sbjct: 432 GMEGEVVTTQDLFVYDILGEDEKGNIIGRHRSTGIGRPAFWDRARYYGEE 481


>gi|170740618|ref|YP_001769273.1| type II secretion system protein E [Methylobacterium sp. 4-46]
 gi|168194892|gb|ACA16839.1| type II secretion system protein E [Methylobacterium sp. 4-46]
          Length = 483

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/414 (70%), Positives = 360/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY  KS IF  LIE ID+ QL++ ++ +AR+EI  ++ EI+++K + MS+ EQ DL
Sbjct: 52  RSEDYYRTKSMIFGALIEAIDLAQLARLEADAAREEIRDIVTEIIALKSVVMSIAEQEDL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+N+ +IEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADVMVNGANRTYIEVAGKIQLTNVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 172 RIVSQVGRRVDEASPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           +++ EGA++LQIIGR+RCNV++SGGTGSGKTTLLNCLTRYID DERI+TCED AELQLQQ
Sbjct: 232 SISPEGAKILQIIGRVRCNVVVSGGTGSGKTTLLNCLTRYIDDDERIITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G+ITMRDL+KNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNLEGQGQITMRDLIKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI+MGG++LPS+ +RE+I  S+DVIVQ  RLRDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLSRIESMISMGGYSLPSKTIREMIAGSVDVIVQAARLRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG VIITQDL  Y+V+GED+ GKLIG+H STG+ RPRFW+RA  YGE++
Sbjct: 412 EVMGMEGEVIITQDLFVYDVVGEDQNGKLIGRHRSTGIGRPRFWDRARYYGEDR 465


>gi|307304376|ref|ZP_07584127.1| type II secretion system protein E [Sinorhizobium meliloti BL225C]
 gi|307318083|ref|ZP_07597519.1| type II secretion system protein E [Sinorhizobium meliloti AK83]
 gi|306896124|gb|EFN26874.1| type II secretion system protein E [Sinorhizobium meliloti AK83]
 gi|306902578|gb|EFN33172.1| type II secretion system protein E [Sinorhizobium meliloti BL225C]
          Length = 476

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/410 (72%), Positives = 352/410 (85%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
            YY +K  IF+ LI  ID+  LS  D + AR+EI  ++N+IV+ KK  +S+ EQ DL  D
Sbjct: 51  QYYSLKKEIFSALIATIDVAALSNMDGEQARNEIGAIINDIVAAKKAGISMAEQNDLLSD 110

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           +CNDILGYGPL+PL+ARDDIADIMVNG+N+VFIEVNG+  ETGI FRDNEQLL++CQRIV
Sbjct: 111 ICNDILGYGPLEPLLARDDIADIMVNGANQVFIEVNGRVQETGIRFRDNEQLLNICQRIV 170

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLA+DGPTLTIRKFKK+KLTLD LV FG+++
Sbjct: 171 SQVGRRVDESSPICDARLGDGSRVNVIAPPLAIDGPTLTIRKFKKEKLTLDQLVRFGSIS 230

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGA +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID  ER++TCED AELQLQQPHV
Sbjct: 231 PEGAEVLKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDHGERVITCEDAAELQLQQPHV 290

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPNIEG+GEITMR+LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 291 VRLETRPPNIEGQGEITMRNLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 350

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+EAMI MGG +LP++ +RE++ SS+DVIVQ  RLRDGSRRIT+I E++
Sbjct: 351 LHANSPREAMARIEAMITMGGSSLPAKTIREMLVSSVDVIVQAARLRDGSRRITHITEVL 410

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           GMEG V+ TQDL  Y+++GEDE G +IG+H STG+ RP FW+RA  YGEE
Sbjct: 411 GMEGEVVTTQDLFVYDILGEDEKGNIIGRHRSTGIGRPAFWDRARYYGEE 460


>gi|114568973|ref|YP_755653.1| type II secretion system protein E [Maricaulis maris MCS10]
 gi|114339435|gb|ABI64715.1| type II secretion system protein E [Maricaulis maris MCS10]
          Length = 508

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/424 (69%), Positives = 362/424 (85%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY +K+TIF  LI+ ID+ QL++ D+++A +EI  ++ EI+S+K + MS+ EQ  L
Sbjct: 84  RSEEYYAIKTTIFNALIDTIDLGQLARLDNETAAEEIRDIVTEIISIKNVAMSIAEQEQL 143

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LG+GPL+PL+ARDDIADIMVNG++KVFIEVNGK  ET I FRDN QL+++CQ
Sbjct: 144 LQDICNDVLGFGPLEPLLARDDIADIMVNGADKVFIEVNGKLEETNIRFRDNAQLMNICQ 203

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL+DGSRVNVI PPLALDGPTLTIRKFKKDKL + +LV FG
Sbjct: 204 RIVSQVGRRVDESSPICDARLMDGSRVNVIAPPLALDGPTLTIRKFKKDKLQMQNLVEFG 263

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           ++T EGA++L IIG  RCNVLISGGTGSGKTTLLNC+T +I++DER+VTCED AELQLQQ
Sbjct: 264 SITPEGAKVLSIIGASRCNVLISGGTGSGKTTLLNCMTGFIEEDERVVTCEDAAELQLQQ 323

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 324 PHVVRLETRPPNLEGSGMVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 383

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE+  R+E+MI MGG+ LP++ +RE+I  S+DVIVQ  RLRDGSR+IT+I 
Sbjct: 384 MGTLHANSPREAMSRIESMITMGGYNLPAKTIREMIVGSIDVIVQAARLRDGSRKITHIT 443

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+VGMEG VI+TQDL  YE+ GEDE GK++GQH STG++RP+FW+RA  +G E+ LA  L
Sbjct: 444 EVVGMEGEVIVTQDLFLYEIKGEDEHGKIVGQHASTGIARPKFWDRARYFGLERELANAL 503

Query: 474 QSLE 477
            + E
Sbjct: 504 DASE 507


>gi|220922782|ref|YP_002498084.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
 gi|219947389|gb|ACL57781.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
          Length = 482

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/430 (68%), Positives = 363/430 (84%), Gaps = 1/430 (0%)

Query: 38  QSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           +S +P A   +     R+  YY  KS IF  LIE ID+ QL++ ++++AR+EI  ++ EI
Sbjct: 36  RSEAPRA-APVAVETARSEEYYRTKSMIFGALIEAIDLAQLARLEAEAAREEIRDIVTEI 94

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           + +K + MS+ EQ DL +D+CND+LGYGPL+PL+ RDDIAD+MVNG+N+ +IEV+GK   
Sbjct: 95  IGLKSVVMSIAEQEDLLDDICNDVLGYGPLEPLLGRDDIADVMVNGANRTYIEVSGKIQL 154

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           T + FRDN+QL+++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIR
Sbjct: 155 TNVRFRDNQQLMNICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIR 214

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KFKKDKLTLD LV FG+++ EGA++LQIIGR+RCNV++SGGTGSGKTTLLNCLTRYID D
Sbjct: 215 KFKKDKLTLDQLVRFGSISPEGAKILQIIGRVRCNVVVSGGTGSGKTTLLNCLTRYIDDD 274

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ERI+TCED AELQLQQPHVVRLETRPPN+EG+G++TMRDL+KNCLRMRPERII+GEVRGP
Sbjct: 275 ERIITCEDAAELQLQQPHVVRLETRPPNLEGQGQVTMRDLIKNCLRMRPERIIVGEVRGP 334

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           E  DLLQAMNTGHDGSMGT+HAN+ RE   R+E+MI+MGG++LPS+ +RE+I  S+DVIV
Sbjct: 335 EAFDLLQAMNTGHDGSMGTLHANSPRECLSRIESMISMGGYSLPSRTIREMIAGSIDVIV 394

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q  RLRDGSRRIT+I E++GMEG+VIITQDL  YEV GED  G+L G+H STG+ RPRFW
Sbjct: 395 QAARLRDGSRRITHITEVMGMEGDVIITQDLFVYEVTGEDANGRLTGRHRSTGIGRPRFW 454

Query: 458 NRAAQYGEEK 467
            RA  YGEE+
Sbjct: 455 ERARYYGEER 464


>gi|254501690|ref|ZP_05113841.1| Type II/IV secretion system protein [Labrenzia alexandrii DFL-11]
 gi|222437761|gb|EEE44440.1| Type II/IV secretion system protein [Labrenzia alexandrii DFL-11]
          Length = 486

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/438 (66%), Positives = 364/438 (83%)

Query: 40  SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS 99
           S P+          +T  YYE K+ IF  L+E ID++QL++ D++ ARDEI  ++N+I++
Sbjct: 42  SVPAEPAAASPSRKKTGEYYETKAQIFNALVEAIDLSQLARLDAEDARDEIRDVVNDIIA 101

Query: 100 VKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETG 159
           +K + MS+ EQ DL ED+CND+LGYGPL+PL+ARDDIADIMVNG++ V+IE  GK   T 
Sbjct: 102 LKNVVMSISEQEDLLEDICNDVLGYGPLEPLLARDDIADIMVNGAHTVYIETQGKVEPTS 161

Query: 160 INFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKF 219
           I FRDN QL+++CQRIV+QVGRRVD++SPICDARL DGSRVNVI PPL+LDGP LTIRKF
Sbjct: 162 IAFRDNAQLMNICQRIVSQVGRRVDDASPICDARLPDGSRVNVIAPPLSLDGPALTIRKF 221

Query: 220 KKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDER 279
           K+DKLTLD LV F ++T EGA +LQ+IGR RCNVLISGGTGSGKTTLLNCLT YI+  ER
Sbjct: 222 KRDKLTLDQLVKFNSITPEGATILQVIGRSRCNVLISGGTGSGKTTLLNCLTAYIENTER 281

Query: 280 IVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEV 339
           I+TCED+AELQLQQPHVVRLETRPPN+EGEGEITMRDLVKNCLRMRPERII+GEVRGPE 
Sbjct: 282 IITCEDSAELQLQQPHVVRLETRPPNLEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEA 341

Query: 340 LDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT 399
            DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI MGGF+LPS+ +RE+I +S+DV+VQ 
Sbjct: 342 FDLLQAMNTGHDGSMGTLHANSPREALSRLESMITMGGFSLPSRTLREMIVASIDVVVQA 401

Query: 400 QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            RLRDGSRRIT++ E++GMEG++I TQD+  Y+++GED  G +IG+H STG+ RP+FW+R
Sbjct: 402 ARLRDGSRRITHVTEVMGMEGDIITTQDIFLYDIVGEDPNGMIIGRHRSTGIGRPKFWDR 461

Query: 460 AAQYGEEKNLAEVLQSLE 477
           A  +GEE  LAE L + E
Sbjct: 462 ARYFGEESRLAEALDASE 479


>gi|307943148|ref|ZP_07658493.1| pilus assembly protein [Roseibium sp. TrichSKD4]
 gi|307773944|gb|EFO33160.1| pilus assembly protein [Roseibium sp. TrichSKD4]
          Length = 491

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/417 (71%), Positives = 356/417 (85%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
            YY+ K+ IF  L+E ID++QL + D+  ARDEI  ++N+I+S+K + MS+ EQ DL ED
Sbjct: 68  EYYQTKAQIFNALVEAIDLSQLGRLDADEARDEIRDVINDIISLKNLVMSISEQEDLLED 127

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           +CND+LGYGPL+PL+ARDDIADIMVNG++ V+IE  GKT  T I FRDN QL+++CQRIV
Sbjct: 128 ICNDVLGYGPLEPLLARDDIADIMVNGAHTVYIETLGKTNITNIKFRDNAQLMNICQRIV 187

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVD+SSPICDARL DGSRVNVI PPL++DGP LTIRKFKKDKLTLD LV FGA+T
Sbjct: 188 SQVGRRVDDSSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKDKLTLDQLVRFGAIT 247

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGA +LQIIGR RCNVLISGGTGSGKTTLLNCLT YI+ DERI+TCED+AELQLQQPHV
Sbjct: 248 PEGAAVLQIIGRSRCNVLISGGTGSGKTTLLNCLTAYIESDERIITCEDSAELQLQQPHV 307

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPNIEGEG+ITM DLVKNCLRMRPERII+GEVRG E  DLLQAMNTGHDGSMGT
Sbjct: 308 VRLETRPPNIEGEGQITMTDLVKNCLRMRPERIIVGEVRGSEAFDLLQAMNTGHDGSMGT 367

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  RE+  R+E+MI MGGF+LPS+ +RE+I SS+DVIVQ  RLRDGSRRIT+I E++
Sbjct: 368 LHANTPREALSRLESMITMGGFSLPSRTLREMICSSIDVIVQASRLRDGSRRITHITEVL 427

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           GMEG+VIITQDL  YE+MGED   K+IG+H STG+ RP+FW++A  YGEE  LA+ L
Sbjct: 428 GMEGDVIITQDLFLYEMMGEDANDKIIGRHRSTGIGRPKFWDKARYYGEEARLAQAL 484


>gi|110636324|ref|YP_676532.1| type II secretion system protein E [Mesorhizobium sp. BNC1]
 gi|110287308|gb|ABG65367.1| type II secretion system protein E [Chelativorans sp. BNC1]
          Length = 500

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/423 (69%), Positives = 370/423 (87%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           YY+ K  +F+ LI+ ID++QL++ D+ SAR+EI  ++N+I+++K + MS+ EQ +L ED+
Sbjct: 77  YYDTKGQVFSALIDTIDLSQLAKLDADSAREEIRDIVNDIIAIKNLAMSISEQEELLEDI 136

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
           CND+LG+GPL+PL+ARD+IADIMVNG+  V+IEVNGK  +T I FRDN+QLL++CQRIV+
Sbjct: 137 CNDVLGFGPLEPLLARDEIADIMVNGARNVYIEVNGKVEQTNIRFRDNQQLLNICQRIVS 196

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKF+KDKLTLD LV  G+++ 
Sbjct: 197 QVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFRKDKLTLDQLVRHGSISP 256

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           EGA +L+IIGR+RCNV+ISGGTGSGKTTLLNCLT +ID+DER++TCED+AELQLQQPHVV
Sbjct: 257 EGAEVLKIIGRVRCNVVISGGTGSGKTTLLNCLTNFIDRDERVITCEDSAELQLQQPHVV 316

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EGEGE+TMRDLV+NCLRMRPERII+GEVRGPEV DLLQAMNTGHDGSMGTI
Sbjct: 317 RLETRPPNLEGEGEVTMRDLVRNCLRMRPERIIVGEVRGPEVFDLLQAMNTGHDGSMGTI 376

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           H+N+ RE   R+E+M+AMGGF+LP + VREII  S+DVI+Q  RLRDGSR IT+I E++G
Sbjct: 377 HSNSPRECLNRIESMVAMGGFSLPQKTVREIIVGSIDVIIQAARLRDGSRHITHISEVLG 436

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           MEG+VI+TQDL+ +++ GED +G++IG+H+STG+ RP FW RA  YGEE  LA  L+++E
Sbjct: 437 MEGDVIVTQDLVVFDIKGEDASGRIIGKHVSTGIGRPAFWERALYYGEEARLAAALEAME 496

Query: 478 KQS 480
           KQ+
Sbjct: 497 KQA 499


>gi|220923698|ref|YP_002499000.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
 gi|219948305|gb|ACL58697.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
          Length = 485

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/414 (71%), Positives = 355/414 (85%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           +T  Y+ +K  IF  L+E+ID++QL+    + AR EI  ++ EIV+ KK+ +S  EQ +L
Sbjct: 57  KTDEYFALKKQIFGALVEIIDVSQLTNMQPEQARIEIRDVVGEIVAAKKVALSTAEQDEL 116

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+CND+LGYGPL+PL+ARDDIADIMVNG N++FIEV GK  ET I FRDN QLLS+CQ
Sbjct: 117 VGDICNDVLGYGPLEPLLARDDIADIMVNGCNRIFIEVGGKIRETDIRFRDNAQLLSICQ 176

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 177 RIVSQVGRRVDEASPICDARLADGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVKFG 236

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIGR+RCN++ISGGTGSGKTTLLNCLT YI+ DERIVTCED AELQLQQ
Sbjct: 237 AISPEGAQILQIIGRVRCNIVISGGTGSGKTTLLNCLTNYIEHDERIVTCEDAAELQLQQ 296

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G+ITMRDLV+NCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 297 PHVVRLETRPPNLEGQGQITMRDLVRNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 356

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF LPS+ +RE+I +S+DVI+Q QRLRDGSRRIT++ 
Sbjct: 357 MGTLHANSPRECLSRLESMITMGGFALPSRTIREMICASVDVIIQAQRLRDGSRRITHVT 416

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+VIITQDL  Y+++GED  GK++G+H STG+ RPRFW+RA  YGEEK
Sbjct: 417 EVLGMEGDVIITQDLFVYDLLGEDAGGKILGRHRSTGIGRPRFWDRARYYGEEK 470


>gi|296444392|ref|ZP_06886357.1| type II secretion system protein E [Methylosinus trichosporium
           OB3b]
 gi|296258039|gb|EFH05101.1| type II secretion system protein E [Methylosinus trichosporium
           OB3b]
          Length = 475

 Score =  635 bits (1637), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 289/422 (68%), Positives = 353/422 (83%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  YY  KS IF  LIE ID+ QLS+ D  +AR+EI  +++EIV++K + MS+ EQ DL
Sbjct: 46  KSEQYYATKSMIFAALIEAIDLAQLSKLDPDNAREEIRDIVHEIVAIKNVVMSISEQEDL 105

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ED+CND+LGYGPL+PL+ RDDIADIMVNG+ K +IEV GK   TGI FRDN QL+++CQ
Sbjct: 106 LEDICNDVLGYGPLEPLLMRDDIADIMVNGATKTYIEVGGKIQLTGIRFRDNAQLMNICQ 165

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARLLDGSRVNVI PPLA+DGP LTIRKF++DKLTLD LV + 
Sbjct: 166 RIVSQVGRRVDESSPICDARLLDGSRVNVIGPPLAIDGPALTIRKFRRDKLTLDQLVRYA 225

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           +++ EG  +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID DER++TCED AELQLQQ
Sbjct: 226 SISPEGGEVLKIIGRVRCNVLISGGTGSGKTTLLNCLTNYIDADERVITCEDAAELQLQQ 285

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 286 PHVVRLETRPPNLEGQGSVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 345

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE+  R+E+MI MGGF+LP++ +R++I SS+D+IVQ  RLRDGSRRIT+I 
Sbjct: 346 MGTLHANSPREALSRLESMITMGGFSLPAKTIRDMIVSSIDIIVQAARLRDGSRRITHIT 405

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++G EG+V+  QDL  YE++GED  G++IG+H STG+ RPRFW RA  YGEE  L   L
Sbjct: 406 EVLGQEGDVVTLQDLFIYEILGEDANGRIIGRHRSTGIGRPRFWERARYYGEENRLGAAL 465

Query: 474 QS 475
            +
Sbjct: 466 DA 467


>gi|218530657|ref|YP_002421473.1| type II secretion system protein E [Methylobacterium
           chloromethanicum CM4]
 gi|218522960|gb|ACK83545.1| type II secretion system protein E [Methylobacterium
           chloromethanicum CM4]
          Length = 482

 Score =  634 bits (1635), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 288/414 (69%), Positives = 357/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  Y+  KS IF  LIE ID+ QL++ + ++AR+EI  +++EI+ +K I +S+ EQ +L
Sbjct: 52  KSEDYFRTKSMIFGALIEAIDLAQLARLEGEAAREEIRDIVSEIIGLKNIVLSIAEQEEL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADVMVNGADRTFIEVAGKIQLTSVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 172 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIG++RCNV+ISGGTGSGKTTLLNCLT +I+ DERI+TCED AELQLQQ
Sbjct: 232 AISPEGAKILQIIGKVRCNVVISGGTGSGKTTLLNCLTAFIEHDERIITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF+LPS+ +RE+IT S+DVI+Q  R+RDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLARIESMITMGGFSLPSRTLREMITGSVDVIIQAMRMRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG VIITQDL  Y+V+GED  G+LIG+H STG+ RPRFW RA  YGEE+
Sbjct: 412 EVMGMEGEVIITQDLFVYDVLGEDANGRLIGRHRSTGIGRPRFWERARYYGEER 465


>gi|254561624|ref|YP_003068719.1| secretory protein kinase, cpaF [Methylobacterium extorquens DM4]
 gi|254268902|emb|CAX24863.1| secretory protein kinase, cpaF [Methylobacterium extorquens DM4]
          Length = 482

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 287/414 (69%), Positives = 357/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  Y+  KS IF  LIE ID+ QL++ + ++AR+EI  +++EI+ +K I +S+ EQ +L
Sbjct: 52  KSEDYFRTKSMIFGALIEAIDLAQLARLEGEAAREEIRDIVSEIIGLKNIVLSIAEQEEL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADVMVNGADRTFIEVAGKIQLTSVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 172 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIG++RCNV+ISGGTGSGKTTLLNCLT +I+ DER++TCED AELQLQQ
Sbjct: 232 AISPEGAKILQIIGKVRCNVVISGGTGSGKTTLLNCLTAFIEHDERVITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF+LPS+ +RE+IT S+DVI+Q  R+RDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLARIESMITMGGFSLPSRTLREMITGSIDVIIQAMRMRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG VIITQDL  Y+V+GED  G+LIG+H STG+ RPRFW RA  YGEE+
Sbjct: 412 EVMGMEGEVIITQDLFVYDVLGEDANGRLIGRHRSTGIGRPRFWERARYYGEER 465


>gi|240139029|ref|YP_002963504.1| secretory protein kinase, cpaF [Methylobacterium extorquens AM1]
 gi|240009001|gb|ACS40227.1| secretory protein kinase, cpaF [Methylobacterium extorquens AM1]
          Length = 482

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 287/414 (69%), Positives = 357/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  Y+  KS IF  LIE ID+ QL++ + ++AR+EI  +++EI+ +K I +S+ EQ +L
Sbjct: 52  KSEDYFRTKSMIFGALIEAIDLAQLARLEGEAAREEIRDIVSEIIGLKNIVLSIAEQEEL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADVMVNGADRTFIEVAGKIQLTSVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 172 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIG++RCNV+ISGGTGSGKTTLLNCLT +I+ DER++TCED AELQLQQ
Sbjct: 232 AISPEGAKILQIIGKVRCNVVISGGTGSGKTTLLNCLTAFIEHDERVITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF+LPS+ +RE+IT S+DVI+Q  R+RDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLARIESMITMGGFSLPSRTLREMITGSIDVIIQAMRMRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG VIITQDL  Y+V+GED  G+LIG+H STG+ RPRFW RA  YGEE+
Sbjct: 412 EVMGMEGEVIITQDLFVYDVLGEDANGRLIGRHRSTGIGRPRFWERARYYGEER 465


>gi|163851906|ref|YP_001639949.1| type II secretion system protein E [Methylobacterium extorquens
           PA1]
 gi|163663511|gb|ABY30878.1| type II secretion system protein E [Methylobacterium extorquens
           PA1]
          Length = 482

 Score =  633 bits (1633), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 287/414 (69%), Positives = 357/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  Y+  KS IF  LIE ID+ QL++ + ++AR+EI  +++EI+ +K I +S+ EQ +L
Sbjct: 52  KSEDYFRTKSMIFGALIEAIDLAQLARLEGEAAREEIRDIVSEIIGLKNIVLSIAEQEEL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADVMVNGADRTFIEVAGKIQLTSVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 172 RIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIG++RCNV+ISGGTGSGKTTLLNCLT +I+ DER++TCED AELQLQQ
Sbjct: 232 AISPEGAKILQIIGKVRCNVVISGGTGSGKTTLLNCLTAFIEHDERVITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF+LPS+ +RE+IT S+DVI+Q  R+RDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLARIESMITMGGFSLPSRTLREMITGSIDVIIQAMRMRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG VIITQDL  Y+V+GED  G+LIG+H STG+ RPRFW RA  YGEE+
Sbjct: 412 EVMGMEGEVIITQDLFVYDVLGEDANGRLIGRHRSTGIGRPRFWERARYYGEER 465


>gi|188581663|ref|YP_001925108.1| type II secretion system protein E [Methylobacterium populi BJ001]
 gi|179345161|gb|ACB80573.1| type II secretion system protein E [Methylobacterium populi BJ001]
          Length = 485

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 286/414 (69%), Positives = 358/414 (86%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  Y+  KS IF  LIE ID+ QL++ + ++AR+EI  +++EI+ +K I +S+ EQ +L
Sbjct: 55  KSEDYFRTKSMIFGALIEAIDLAQLARLEGEAAREEIRDIVSEIIGLKNIVLSIAEQEEL 114

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIAD+MVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 115 LDDICNDVLGYGPLEPLLARDDIADVMVNGADRTFIEVAGKIQLTSVRFRDNQQLMNICQ 174

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTLD LV FG
Sbjct: 175 RIVSQVGRRVDEASPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLDQLVRFG 234

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA++LQIIG++RCNV+ISGGTGSGKTTLLNCLT +I+ DER++TCED AELQLQQ
Sbjct: 235 AISPEGAKILQIIGKVRCNVVISGGTGSGKTTLLNCLTAFIEHDERVITCEDAAELQLQQ 294

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 295 PHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 354

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI MGGF+LPS+ +RE+IT S+DVI+Q  R+RDGSRRIT+I 
Sbjct: 355 MGTLHANSPRECLARIESMITMGGFSLPSRTLREMITGSVDVIIQAMRMRDGSRRITHIT 414

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEK 467
           E++GMEG+VIITQDL  Y+V+GED  G+LIG+H STG+ RPRFW RA  YGEE+
Sbjct: 415 EVMGMEGDVIITQDLFVYDVLGEDANGRLIGRHRSTGIGRPRFWERARYYGEER 468


>gi|154250692|ref|YP_001411516.1| type II secretion system protein E [Parvibaculum lavamentivorans
           DS-1]
 gi|154154642|gb|ABS61859.1| type II secretion system protein E [Parvibaculum lavamentivorans
           DS-1]
          Length = 482

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 287/436 (65%), Positives = 365/436 (83%), Gaps = 3/436 (0%)

Query: 38  QSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           Q+  P+A     +   R+ +YY++K+TIF  LI+ ID+TQL+Q DS+SAR+EI  ++NEI
Sbjct: 45  QAPKPAAPARSDH---RSENYYQIKTTIFNALIDTIDLTQLAQLDSESAREEIRDIVNEI 101

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           +S+K + MS+ EQ  L +D+CND+LGYGPL+PL+ARDDIADIMVNG  + FIEVNGK   
Sbjct: 102 LSIKNVVMSISEQEALLQDICNDVLGYGPLEPLLARDDIADIMVNGCERTFIEVNGKVEL 161

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           T I FRDN QL+++CQRIV+QVGRRVDESSPICDARL DGSRVNVI+PPLA+DGP LTIR
Sbjct: 162 TNIRFRDNSQLMNICQRIVSQVGRRVDESSPICDARLPDGSRVNVIVPPLAIDGPALTIR 221

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KF++DKL ++ LV + +++ EGA +L IIG++RCNVLISGGTGSGKTTLLNCLT +ID D
Sbjct: 222 KFRRDKLMMNDLVQYNSISQEGAEVLGIIGKVRCNVLISGGTGSGKTTLLNCLTGFIDTD 281

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ER++TCED AELQLQQPHVVRLETRPPN+EG+G++TM +LV+NCLRMRPERII+GEVRGP
Sbjct: 282 ERVITCEDAAELQLQQPHVVRLETRPPNLEGQGQVTMTELVRNCLRMRPERIIVGEVRGP 341

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           E  DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI MGG+ LPS+ +RE+I  S+DV++
Sbjct: 342 EAFDLLQAMNTGHDGSMGTLHANSPREALSRLESMITMGGYALPSKTIREMICGSIDVVI 401

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q  RLRDGSRRIT+I E++G EG+VIITQDL  Y++ GEDETG++IG+H STG++RP FW
Sbjct: 402 QAARLRDGSRRITHITEVLGTEGDVIITQDLFVYDIEGEDETGRIIGKHKSTGIARPSFW 461

Query: 458 NRAAQYGEEKNLAEVL 473
           +RA  Y + + LA  L
Sbjct: 462 DRARYYNQHQALAAAL 477


>gi|170750192|ref|YP_001756452.1| type II secretion system protein E [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656714|gb|ACB25769.1| type II secretion system protein E [Methylobacterium radiotolerans
           JCM 2831]
          Length = 480

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 289/424 (68%), Positives = 360/424 (84%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  YY  KS IF  LIE ID+TQLS+ D+++AR+EI  ++ EI+ +K I +S+ EQ +L
Sbjct: 52  RSEDYYRTKSLIFGALIEAIDLTQLSRLDAETAREEIRDIVTEIIGLKNIVLSISEQEEL 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +D+CND+LGYGPL+PL+ARDDIADIMVNG+++ FIEV GK   T + FRDN+QL+++CQ
Sbjct: 112 LDDICNDVLGYGPLEPLLARDDIADIMVNGAHRTFIEVGGKIQLTSVRFRDNQQLMNICQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVD++SPICDARL DGSRVNVI PPLA+DGP LTIRKFKKDKLTL+ LV FG
Sbjct: 172 RIVSQVGRRVDDASPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDKLTLEQLVRFG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA +L+IIG+ RCNV+ISGGTGSGKTTLLNCLT +I+ DER++TCED AELQLQQ
Sbjct: 232 AISPEGAEVLKIIGQSRCNVVISGGTGSGKTTLLNCLTAFIEHDERVITCEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 292 PHVVRLETRPPNMEGQGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE   R+E+MI+MGGF+LPS+ +RE+I  S+DV++Q  RLRDGSRRIT+I 
Sbjct: 352 MGTLHANSPRECLSRIESMISMGGFSLPSRTLREMICGSIDVVIQAMRLRDGSRRITHIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VI TQD+  Y+++GED  GKLIG+H STGV RP+FW RA  YG E+ L E L
Sbjct: 412 EVLGMEGDVITTQDVFLYDIVGEDANGKLIGRHRSTGVGRPKFWERARYYGLEQRLGEAL 471

Query: 474 QSLE 477
            + E
Sbjct: 472 DAAE 475


>gi|36958875|gb|AAQ87300.1| Secretory protein kinase, CpaF [Sinorhizobium fredii NGR234]
          Length = 474

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 290/413 (70%), Positives = 346/413 (83%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           +   YY  K  IF+ LI  ID+  LS  D   AR EI  ++N+IV+ KK  +S+ EQ +L
Sbjct: 46  KADQYYSFKKEIFSALIATIDVAALSTMDGDEARTEIGAIVNDIVAAKKAGISMAEQNEL 105

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+CNDILGYGPL+PL+ARDDIADIMVNG+++VFIEV G+  +TGI FRDNEQLL++CQ
Sbjct: 106 LRDICNDILGYGPLEPLLARDDIADIMVNGADQVFIEVGGRVQQTGIRFRDNEQLLNICQ 165

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGP+LTIRKFKK+KL LD LV FG
Sbjct: 166 RIVSQVGRRVDEASPICDARLADGSRVNVIAPPLAIDGPSLTIRKFKKEKLNLDQLVRFG 225

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           +++ EGA +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID  ERI+TCED AELQLQQ
Sbjct: 226 SISPEGAEILKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDDGERIITCEDAAELQLQQ 285

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEG+GEITMR LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 286 PHVVRLETRPPNIEGQGEITMRSLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 345

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE+  R+EAMI MGG +LP + +RE++ SS+DVIVQ  RLRDGSRRIT+I 
Sbjct: 346 MGTLHANSPREAISRVEAMITMGGHSLPGKAIREMLVSSVDVIVQAARLRDGSRRITHIT 405

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           E++GMEG+V+ TQDL  Y+++GED  G +IG+H STG+ RP FW+RA  YGEE
Sbjct: 406 EVLGMEGDVVTTQDLFVYDILGEDGKGNIIGRHRSTGIGRPAFWDRARYYGEE 458


>gi|227818619|ref|YP_002822590.1| CpaF protein secretory protein kinase [Sinorhizobium fredii NGR234]
 gi|227337618|gb|ACP21837.1| CpaF protein secretory protein kinase [Sinorhizobium fredii NGR234]
          Length = 447

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 290/413 (70%), Positives = 346/413 (83%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           +   YY  K  IF+ LI  ID+  LS  D   AR EI  ++N+IV+ KK  +S+ EQ +L
Sbjct: 19  KADQYYSFKKEIFSALIATIDVAALSTMDGDEARTEIGAIVNDIVAAKKAGISMAEQNEL 78

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+CNDILGYGPL+PL+ARDDIADIMVNG+++VFIEV G+  +TGI FRDNEQLL++CQ
Sbjct: 79  LRDICNDILGYGPLEPLLARDDIADIMVNGADQVFIEVGGRVQQTGIRFRDNEQLLNICQ 138

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGP+LTIRKFKK+KL LD LV FG
Sbjct: 139 RIVSQVGRRVDEASPICDARLADGSRVNVIAPPLAIDGPSLTIRKFKKEKLNLDQLVRFG 198

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           +++ EGA +L+IIGR+RCNVLISGGTGSGKTTLLNCLT YID  ERI+TCED AELQLQQ
Sbjct: 199 SISPEGAEILKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDDGERIITCEDAAELQLQQ 258

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPNIEG+GEITMR LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGS
Sbjct: 259 PHVVRLETRPPNIEGQGEITMRSLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGS 318

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGT+HAN+ RE+  R+EAMI MGG +LP + +RE++ SS+DVIVQ  RLRDGSRRIT+I 
Sbjct: 319 MGTLHANSPREAISRVEAMITMGGHSLPGKAIREMLVSSVDVIVQAARLRDGSRRITHIT 378

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           E++GMEG+V+ TQDL  Y+++GED  G +IG+H STG+ RP FW+RA  YGEE
Sbjct: 379 EVLGMEGDVVTTQDLFVYDILGEDGKGNIIGRHRSTGIGRPAFWDRARYYGEE 431


>gi|254293217|ref|YP_003059240.1| type II secretion system protein E [Hirschia baltica ATCC 49814]
 gi|254041748|gb|ACT58543.1| type II secretion system protein E [Hirschia baltica ATCC 49814]
          Length = 509

 Score =  625 bits (1613), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 365/471 (77%), Gaps = 5/471 (1%)

Query: 12  SVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVN-----RTPHYYEVKSTIF 66
           S K+E + P+P      S        +S+ P  + E           R+  YY VK+ IF
Sbjct: 37  SEKQEASTPIPAPQASPSPTPPPVKAKSAPPLVKKEKAKPAKSEDEGRSEEYYLVKTEIF 96

Query: 67  TTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGP 126
             LI+ ID++QL+Q D +SAR+EI  ++ EI+S+K + MSL EQ  L ED+CND+LGYGP
Sbjct: 97  NALIDTIDLSQLAQLDQESAREEIRDIVIEIISIKNVVMSLAEQEVLLEDICNDVLGYGP 156

Query: 127 LQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDES 186
           L+PL+ARDDIADIMVNG+N  +IEVNGK   T I FRDN QL+++CQRIV+QVGRRVDES
Sbjct: 157 LEPLLARDDIADIMVNGANCTYIEVNGKIERTNIRFRDNGQLMNICQRIVSQVGRRVDES 216

Query: 187 SPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQII 246
           SPICDARL DGSRVNVI PPLA+DGPTLTIRKF+KDKLT+ +LV FGA++  GA +L+II
Sbjct: 217 SPICDARLADGSRVNVIAPPLAIDGPTLTIRKFRKDKLTIQNLVEFGAISPAGAEILRII 276

Query: 247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNI 306
           G  RCNVLISGGTGSGKTTLLNCLT +I+  ER++TCED AELQLQQPHVVRLETRPPNI
Sbjct: 277 GTSRCNVLISGGTGSGKTTLLNCLTAFIEPGERVITCEDAAELQLQQPHVVRLETRPPNI 336

Query: 307 EGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESF 366
           EG+G++TM DLVKNCLRMRP+RII+GEVRGPE  DLLQAMNTGHDGSMGT+HAN  RE  
Sbjct: 337 EGQGKVTMTDLVKNCLRMRPDRIIVGEVRGPEAFDLLQAMNTGHDGSMGTLHANTPREGL 396

Query: 367 GRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQ 426
            R+E+MI MGGF LP + +RE+I  S+DV++Q  RLRDGSR+I +I E++G+EG+VI+TQ
Sbjct: 397 SRVESMITMGGFALPQRTIREMIVGSIDVVIQATRLRDGSRKIVSISEVMGLEGDVIVTQ 456

Query: 427 DLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           D+L+YE+ GED+ GKLIG+H  TGV RPRFW RA  Y  E  L   L  LE
Sbjct: 457 DVLRYEIDGEDKNGKLIGRHRGTGVGRPRFWERAKYYNLEAELGLALDQLE 507


>gi|300021857|ref|YP_003754468.1| type II secretion system protein E [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523678|gb|ADJ22147.1| type II secretion system protein E [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 494

 Score =  624 bits (1610), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 296/470 (62%), Positives = 367/470 (78%), Gaps = 6/470 (1%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQ-----KQNLQSSSPSAEGEIGNFVNRT 55
           MFGRR      S KR D   +P    V+   I+     +Q   ++ P  E         +
Sbjct: 1   MFGRRSND-PASTKRSDPQVVPVAQPVAPPEIKAPPQARQPAPAAQPRPEPPAEVHRRHS 59

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
             YY+VK+T+F  LI+ ID+TQL++ D+ +AR+EI  +++EI+ VK + MS+ EQ +L E
Sbjct: 60  EEYYDVKTTVFNALIDTIDLTQLAKLDAVAAREEIRDIVSEIIQVKNVVMSIAEQEELLE 119

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+CND+LGYGPL+PL+ARDDIADIMVNG++  FIEV GK  +T + F DN+QL+++CQRI
Sbjct: 120 DICNDVLGYGPLEPLLARDDIADIMVNGASTTFIEVAGKVQKTSVRFADNQQLMNICQRI 179

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+QVGRRVDESSPICDARL DGSRVNVI PPLA+DGP LTIRKFKKD+L L+ LV FG++
Sbjct: 180 VSQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGPALTIRKFKKDRLKLEQLVKFGSI 239

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T E   +L++IGR+RCNV+ISGGTGSGKTTLLNCLT  ID DERI+TCED+AELQLQQPH
Sbjct: 240 TPEAKTILEVIGRVRCNVVISGGTGSGKTTLLNCLTGSIDNDERIITCEDSAELQLQQPH 299

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRPPNIEGEGEI MRDL+KNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMG
Sbjct: 300 VVRLETRPPNIEGEGEIRMRDLIKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMG 359

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HAN+ RE+  R+E+MI  GG+ LP + +RE+I  S+DVIVQ  RLRDGSR+IT+I E+
Sbjct: 360 TLHANSPREALSRLESMIMQGGYALPIKTIREMICGSIDVIVQASRLRDGSRKITHITEV 419

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGE 465
           +GME   I  Q+LL YE+ GED  GKL G+H STG++RPRFW+RA  YGE
Sbjct: 420 LGMEEETITLQNLLVYEITGEDAHGKLTGRHRSTGIARPRFWDRAEYYGE 469


>gi|304392381|ref|ZP_07374322.1| secretory protein kinase, CpaF [Ahrensia sp. R2A130]
 gi|303295485|gb|EFL89844.1| secretory protein kinase, CpaF [Ahrensia sp. R2A130]
          Length = 563

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 294/424 (69%), Positives = 361/424 (85%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           ++  YY+VK+ +F+ LI+ ID++QLS+ D++ AR+EI  ++N+IV++K I MS+ EQ +L
Sbjct: 135 KSEEYYDVKTQVFSALIDTIDLSQLSKLDNEGAREEIRDIVNDIVAIKSIVMSISEQEEL 194

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+CND+LGYGPL+PL+ RDDIADIMVNG+ + FIEV+GKT  T + FRDN+QL+++CQ
Sbjct: 195 LADICNDVLGYGPLEPLLERDDIADIMVNGAKQTFIEVDGKTQNTNVRFRDNDQLMNICQ 254

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLTLD LV FG
Sbjct: 255 RIVSQVGRRVDESSPICDARLADGSRVNVIAPPLALDGPTLTIRKFKKDKLTLDQLVKFG 314

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A++ EGA +L+IIGR+RCN++ISGGTGSGKTTLLNC+T YID+DER++TCED+AELQLQQ
Sbjct: 315 AISEEGAEVLKIIGRVRCNIVISGGTGSGKTTLLNCMTNYIDEDERVITCEDSAELQLQQ 374

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETRPPN+EGEG+ITM DLVKNCLRMRPERII+GEVRG EV DLLQAMNTGHDGS
Sbjct: 375 PHVVRLETRPPNLEGEGKITMTDLVKNCLRMRPERIIVGEVRGSEVFDLLQAMNTGHDGS 434

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           MGTIH+N+ RE   RME+MIAMGGF LP + VREII  S+D+I+Q +RLRDGSRRIT+I 
Sbjct: 435 MGTIHSNSPRECLSRMESMIAMGGFQLPQKTVREIICGSIDIIIQAKRLRDGSRRITHIT 494

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E++GMEG+VIITQD+  Y+++GED  GKLIG+H S GV  P+   RA  YGE   LA  L
Sbjct: 495 EVLGMEGDVIITQDIFLYDIVGEDADGKLIGKHRSCGVGNPKMAERAKYYGEGPRLAAAL 554

Query: 474 QSLE 477
            + E
Sbjct: 555 DASE 558


>gi|218672464|ref|ZP_03522133.1| pilus assembly secretion ATP-binding protein [Rhizobium etli GR56]
          Length = 380

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 289/379 (76%), Positives = 336/379 (88%)

Query: 103 ITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINF 162
             MS+ EQ +L ED+CND+LGYGPL+PL+ARDDIADIMVNG+ + FIEV GKT+E+ I F
Sbjct: 1   FAMSISEQEELLEDICNDVLGYGPLEPLLARDDIADIMVNGAGQTFIEVGGKTIESEIRF 60

Query: 163 RDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKD 222
           RDN QLLS+CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKFKKD
Sbjct: 61  RDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKFKKD 120

Query: 223 KLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVT 282
           KLTLD LV FGA+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+DER++T
Sbjct: 121 KLTLDQLVRFGAITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLTNYIDRDERVIT 180

Query: 283 CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDL 342
           CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRGPEV DL
Sbjct: 181 CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRGPEVFDL 240

Query: 343 LQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRL 402
           LQAMNTGHDGSMGTIHAN  RE   R+E+MIAMGGFTLP++ VREII++S+DVI+Q  RL
Sbjct: 241 LQAMNTGHDGSMGTIHANTPRECLSRIESMIAMGGFTLPAKTVREIISTSVDVIIQAARL 300

Query: 403 RDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQ 462
           RDGSRRIT I E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P FW+RA  
Sbjct: 301 RDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMSTGVGKPHFWDRARY 360

Query: 463 YGEEKNLAEVLQSLEKQSR 481
           + EEK LA  L ++E +++
Sbjct: 361 FNEEKRLAAALDAMEAKTK 379


>gi|329847256|ref|ZP_08262284.1| cpaF [Asticcacaulis biprosthecum C19]
 gi|328842319|gb|EGF91888.1| cpaF [Asticcacaulis biprosthecum C19]
          Length = 544

 Score =  623 bits (1606), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 285/421 (67%), Positives = 356/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+ IF  L+  ID++QL+Q D ++A +EI  ++ E+V++K ++MS+ EQ +L +D
Sbjct: 124 YYHATKTAIFNALLNTIDLSQLAQLDHKAASEEIRDIVAELVAIKNVSMSVAEQDNLVQD 183

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+ +VFIEVNGK   T + FRDN+QL+++CQRIV
Sbjct: 184 IINDVLGYGPLEPLLARDDIADIMVNGAQRVFIEVNGKVQLTNVRFRDNQQLMNICQRIV 243

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV F +++
Sbjct: 244 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMRNLVEFNSIS 303

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCNVLISGGTGSGKTTLLN +T +ID  ER+VTCED AELQLQQPHV
Sbjct: 304 PEGARVLGVIGASRCNVLISGGTGSGKTTLLNTMTAFIDPTERVVTCEDAAELQLQQPHV 363

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 364 VRLETRPPNLEGQGTITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 423

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGG+ LPS+ +RE+I  S+D+I+Q  RLRDGSRRIT+I E++
Sbjct: 424 LHANSPREAVSRLESMITMGGYGLPSRTIREMIVGSIDLIIQAARLRDGSRRITHITEVL 483

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  YE+ GED+ GK+IG+H STG+ RPRFW+RA  YG E+ LAE L + 
Sbjct: 484 GLEGDVIVTQDLFLYEIEGEDKQGKIIGRHRSTGIGRPRFWDRAKYYGLERELAEALDAS 543

Query: 477 E 477
           E
Sbjct: 544 E 544


>gi|83859360|ref|ZP_00952881.1| pilus assembly protein CpaF [Oceanicaulis alexandrii HTCC2633]
 gi|83852807|gb|EAP90660.1| pilus assembly protein CpaF [Oceanicaulis alexandrii HTCC2633]
          Length = 512

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 288/426 (67%), Positives = 357/426 (83%), Gaps = 3/426 (0%)

Query: 40  SSPSAE-GEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV 98
           + P+A+   IG    R+  YY VK+TIF  LI+ ID+ QL++ D+++ARDEI  ++ EI+
Sbjct: 75  AKPAAQLANIG--AERSAEYYAVKTTIFNALIDTIDLGQLARLDNETARDEIRDIVTEII 132

Query: 99  SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVET 158
           S+K + MS+ EQ  L +D+CND+LGYGPL+PL+ RDDIADIMVNG+  VFIEV GK  +T
Sbjct: 133 SIKNVAMSIAEQEQLLQDICNDVLGYGPLEPLLERDDIADIMVNGAGDVFIEVKGKVQKT 192

Query: 159 GINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRK 218
            I FRDN QL+++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRK
Sbjct: 193 NIRFRDNGQLMNICQRIVSQVGRRVDESSPICDARLADGSRVNVIAPPLALDGPTLTIRK 252

Query: 219 FKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDE 278
           FKKDKL L +LV FG+++ EGAR+L+IIG  R NVLISGGTGSGKTTLLNCLT +I +DE
Sbjct: 253 FKKDKLKLQNLVEFGSISPEGARILEIIGACRANVLISGGTGSGKTTLLNCLTGFIGEDE 312

Query: 279 RIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPE 338
           RI+TCED AELQLQQPHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERII+GEVRG E
Sbjct: 313 RIITCEDAAELQLQQPHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIIVGEVRGSE 372

Query: 339 VLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQ 398
             DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI MGG+ LP++ +RE+I+ S+DVI+Q
Sbjct: 373 AFDLLQAMNTGHDGSMGTLHANSPREALSRIESMITMGGYNLPTKTIREMISGSIDVIIQ 432

Query: 399 TQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWN 458
             RLRDGSR+IT+I E++GMEG+VIITQDL  YE+ GED+ G + G+H+STG++RP FW 
Sbjct: 433 AARLRDGSRKITHITEVLGMEGDVIITQDLFLYEITGEDQNGDITGRHVSTGIARPNFWE 492

Query: 459 RAAQYG 464
           RA  +G
Sbjct: 493 RARYFG 498


>gi|302381753|ref|YP_003817576.1| type II secretion system protein E [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192381|gb|ADK99952.1| type II secretion system protein E [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 543

 Score =  621 bits (1602), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 283/421 (67%), Positives = 354/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID+ QL+Q D+++A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 123 YYHATKTTIFNALMNTIDLAQLAQLDTKAASEEIRDIVAELVAIKNVSMSVAEQEHLVQD 182

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ RDDIADIMVNG+ +VFIEVNGK   T + FRDN QL+++CQRIV
Sbjct: 183 IVNDVLGYGPLEPLLNRDDIADIMVNGAGRVFIEVNGKVQLTNVRFRDNTQLMNICQRIV 242

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLA+DG TLTIRKFKKDKLT+ +LV + +++
Sbjct: 243 SQVGRRVDESSPICDARLPDGSRVNVIAPPLAIDGATLTIRKFKKDKLTMKNLVEYASIS 302

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN LT +ID  ER++TCED AELQLQQPHV
Sbjct: 303 PEGARVLGVIGACRCNIVISGGTGSGKTTLLNTLTAFIDPTERVITCEDAAELQLQQPHV 362

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 363 VRLETRPPNLEGQGTITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 422

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  RME+MI MGG+ LPS+ +RE+I  S+DVI+Q  RLRDGSRRIT+I E+V
Sbjct: 423 LHANSPREAISRMESMITMGGYGLPSRTIREMIVGSVDVIIQAARLRDGSRRITHITEVV 482

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  YE+ GEDE GK++G+H STG++RPRFW+RA  YG E+ LAE L + 
Sbjct: 483 GLEGDVIVTQDLFVYEITGEDENGKIVGRHRSTGIARPRFWDRARYYGLERELAEALDAA 542

Query: 477 E 477
           E
Sbjct: 543 E 543


>gi|254419252|ref|ZP_05032976.1| Type II/IV secretion system protein [Brevundimonas sp. BAL3]
 gi|196185429|gb|EDX80405.1| Type II/IV secretion system protein [Brevundimonas sp. BAL3]
          Length = 548

 Score =  621 bits (1602), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 284/421 (67%), Positives = 355/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID+ QL+Q D+++A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 128 YYHATKTTIFNALMNTIDLAQLAQLDTKAASEEIRDIVAELVAIKNVSMSVAEQEHLVQD 187

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+ +VFIEV GK   T + FRDN QL+++CQRIV
Sbjct: 188 IVNDVLGYGPLEPLLARDDIADIMVNGAGRVFIEVGGKVQLTNVRFRDNAQLMNICQRIV 247

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV + +++
Sbjct: 248 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMKNLVEYASIS 307

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN LT +ID  ER++TCED AELQLQQPHV
Sbjct: 308 PEGARVLGVIGASRCNLVISGGTGSGKTTLLNTLTAFIDPTERVITCEDAAELQLQQPHV 367

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 368 VRLETRPPNLEGQGMITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 427

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  RME+MI MGG+ LPS+ +RE+I  S+DVI+Q  RLRDGSRRIT+I E+V
Sbjct: 428 LHANSPREAISRMESMITMGGYGLPSRTIREMIVGSVDVIIQAARLRDGSRRITHITEVV 487

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  Y++ GEDE GK+IG+H STG++RPRFW+RA  YG E+ LA+ L + 
Sbjct: 488 GLEGDVIVTQDLFVYDITGEDENGKIIGRHRSTGIARPRFWDRARYYGLERELADALDAA 547

Query: 477 E 477
           E
Sbjct: 548 E 548


>gi|315497462|ref|YP_004086266.1| type II secretion system protein e [Asticcacaulis excentricus CB
           48]
 gi|315415474|gb|ADU12115.1| type II secretion system protein E [Asticcacaulis excentricus CB
           48]
          Length = 538

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 285/421 (67%), Positives = 355/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+ IF  L+  ID++QL+Q D ++A +EI  +++E+V++K ++MS  EQ  L +D
Sbjct: 118 YYHATKTAIFNALLNTIDLSQLAQLDQKAAAEEIRDIVSELVTIKNVSMSNAEQDALVQD 177

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+ +VFIEV+GK   T + FRDN QL+++CQRIV
Sbjct: 178 IINDVLGYGPLEPLLARDDIADIMVNGAGRVFIEVSGKVQLTNVRFRDNAQLMNICQRIV 237

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV FG+++
Sbjct: 238 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMRNLVEFGSIS 297

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCNVLISGGTGSGKTTLLN +T +ID  ER++TCED AELQLQQPHV
Sbjct: 298 PEGARVLGVIGASRCNVLISGGTGSGKTTLLNTMTAFIDPTERVITCEDAAELQLQQPHV 357

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 358 VRLETRPPNLEGQGAITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 417

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGG+ LPS+ +RE+I  S+D+IVQ  RLRDGSRRIT+I E++
Sbjct: 418 LHANSPREAISRLESMITMGGYGLPSRTIREMIVGSVDIIVQAARLRDGSRRITHITEVL 477

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VIITQDL  YE+ GE++ GK+IG+H STG+ RPRFW+RA  YG E+ LAE L + 
Sbjct: 478 GLEGDVIITQDLFLYEIEGENKEGKIIGRHRSTGIGRPRFWDRARYYGLERELAEALDAA 537

Query: 477 E 477
           E
Sbjct: 538 E 538


>gi|114800387|ref|YP_761688.1| pilus assembly protein CpaF [Hyphomonas neptunium ATCC 15444]
 gi|114740561|gb|ABI78686.1| pilus assembly protein CpaF [Hyphomonas neptunium ATCC 15444]
          Length = 495

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 286/420 (68%), Positives = 352/420 (83%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
            YY  K+TIF  LI+ ID++QL+Q D++SAR+EI  ++ EI+S+K + MS+ EQ  L +D
Sbjct: 73  QYYATKTTIFNALIDTIDLSQLAQLDTESAREEIRDIVVEIISIKNVVMSISEQEYLLDD 132

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           +CND+LGYGPL+PL+ARDDIADIMVNG++  +IEVNGK   T I FRDN QL+++CQRIV
Sbjct: 133 ICNDVLGYGPLEPLLARDDIADIMVNGADTTYIEVNGKIERTNIRFRDNAQLMNICQRIV 192

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARLLDGSRVNVI PPLA+DGPTLTIRKFKKDKL L+ LV FG+++
Sbjct: 193 SQVGRRVDESSPICDARLLDGSRVNVIAPPLAIDGPTLTIRKFKKDKLKLNDLVRFGSIS 252

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
             GA +L+IIG  RCNVLISGGTGSGKTTLLNCLT +I+  ER++TCED+AELQLQQPHV
Sbjct: 253 ECGAEILRIIGHSRCNVLISGGTGSGKTTLLNCLTGFIEPGERVITCEDSAELQLQQPHV 312

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPNIEG GEITMR+LVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 313 VRLETRPPNIEGSGEITMRELVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 372

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGGF+LP++ +RE+I  S+D++VQ  RLRDGSRRI  I E++
Sbjct: 373 LHANSPREALSRVESMITMGGFSLPAKTIREMIVGSIDIVVQASRLRDGSRRIMCITEVL 432

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+ I+ QD++KYE+ GEDE GK+IG+H   G+ RPRFW RA+ Y  E+ LA  L  L
Sbjct: 433 GLEGDTIVLQDIMKYEIDGEDEDGKIIGRHRGLGIGRPRFWERASYYNLERELAAALDEL 492


>gi|295690795|ref|YP_003594488.1| type II secretion system protein E [Caulobacter segnis ATCC 21756]
 gi|295432698|gb|ADG11870.1| type II secretion system protein E [Caulobacter segnis ATCC 21756]
          Length = 491

 Score =  617 bits (1592), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 366/457 (80%), Gaps = 1/457 (0%)

Query: 22  PQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEV-KSTIFTTLIEMIDITQLSQ 80
           P E V  S  +     ++ +  A       V     YY V K+TIF  L+  ID++QL+Q
Sbjct: 35  PAEPVAPSPKVTGPPPRALAHQAAPLAAPIVREQSDYYHVTKTTIFNALLNTIDLSQLAQ 94

Query: 81  YDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIM 140
            D + A +EI  ++ E+V++K ++MS+ EQ  L +D+ ND+LGYGPL+PL+ARDDIADIM
Sbjct: 95  LDQRQAAEEIRDIVAELVAIKNVSMSVSEQEALVQDITNDVLGYGPLEPLLARDDIADIM 154

Query: 141 VNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRV 200
           VNG+++VFIEV GK   T + FRDN+QL+++CQRIV+QVGRRVDESSPICDARL DGSRV
Sbjct: 155 VNGAHRVFIEVGGKVQLTNVRFRDNQQLMNICQRIVSQVGRRVDESSPICDARLPDGSRV 214

Query: 201 NVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTG 260
           NVI PPLALDGPTLTIRKF++DKLT+ +LV + +++ EGAR+L +IG  RCNV+ISGGTG
Sbjct: 215 NVIAPPLALDGPTLTIRKFRRDKLTMKNLVEYASISPEGARVLGVIGACRCNVIISGGTG 274

Query: 261 SGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKN 320
           SGKTTLLN +T +ID  ER+VTCED AELQLQQPHVVRLETRPPN+EG+G +TMRDLV+N
Sbjct: 275 SGKTTLLNTMTAFIDPTERVVTCEDAAELQLQQPHVVRLETRPPNLEGQGAVTMRDLVRN 334

Query: 321 CLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTL 380
           CLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI MGG+ L
Sbjct: 335 CLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTLHANSPREALSRVESMITMGGYGL 394

Query: 381 PSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETG 440
           PS+ ++E+I  S+DVI+Q  RLRDGSRRIT+I E+VG+EG+V++TQDL  Y++ GEDE G
Sbjct: 395 PSKTIKEMIVGSVDVIIQAARLRDGSRRITHITEVVGLEGDVVVTQDLFVYDITGEDEHG 454

Query: 441 KLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           K++G+H STG++RP+FW+RA  YG E+ LAE L + E
Sbjct: 455 KVLGRHRSTGIARPKFWDRARYYGLERELAEALDAAE 491


>gi|7208428|gb|AAF40195.1|AF229646_7 CpaF [Caulobacter crescentus CB15]
          Length = 501

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 283/421 (67%), Positives = 354/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID++QL+Q D + A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 81  YYHATKTTIFNALLNTIDLSQLAQLDLKQAGEEIRDIVAELVAIKNVSMSVAEQEHLVQD 140

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+++VFIEV GK   T + FRDN QL+++CQRIV
Sbjct: 141 IINDVLGYGPLEPLLARDDIADIMVNGAHRVFIEVGGKVQLTNVRFRDNLQLMNICQRIV 200

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV F +++
Sbjct: 201 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMKNLVEFASIS 260

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN +T +ID  ER+VTCED AELQLQQPHV
Sbjct: 261 PEGARVLGVIGACRCNLVISGGTGSGKTTLLNTMTAFIDPTERVVTCEDAAELQLQQPHV 320

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 321 VRLETRPPNLEGSGAVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 380

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGG+ LPS+ ++E+I  S+DVI+Q  RLRDGSRRIT+I E+V
Sbjct: 381 LHANSPREAISRIESMITMGGYGLPSKTIKEMIVGSVDVIIQAARLRDGSRRITHITEVV 440

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  YE+ GEDE GK++G+H STG++RPRFW+RA  YG E+ LAE L + 
Sbjct: 441 GLEGDVIVTQDLFVYEITGEDEHGKVVGKHRSTGIARPRFWDRARYYGLERELAEALDAA 500

Query: 477 E 477
           E
Sbjct: 501 E 501


>gi|16127172|ref|NP_421736.1| pilus assembly protein CpaF [Caulobacter crescentus CB15]
 gi|221235973|ref|YP_002518410.1| pilus assembly ATPase CpaF [Caulobacter crescentus NA1000]
 gi|13424568|gb|AAK24904.1| pilus assembly protein CpaF [Caulobacter crescentus CB15]
 gi|220965146|gb|ACL96502.1| pilus assembly ATPase CpaF [Caulobacter crescentus NA1000]
          Length = 501

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 283/421 (67%), Positives = 354/421 (84%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID++QL+Q D + A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 81  YYHATKTTIFNALLNTIDLSQLAQLDLKQAGEEIRDIVAELVAIKNVSMSVAEQEHLVQD 140

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+++VFIEV GK   T + FRDN QL+++CQRIV
Sbjct: 141 IINDVLGYGPLEPLLARDDIADIMVNGAHRVFIEVGGKVQLTNVRFRDNLQLMNICQRIV 200

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV F +++
Sbjct: 201 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMKNLVEFASIS 260

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN +T +ID  ER+VTCED AELQLQQPHV
Sbjct: 261 PEGARVLGVIGACRCNLVISGGTGSGKTTLLNTMTAFIDPTERVVTCEDAAELQLQQPHV 320

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 321 VRLETRPPNLEGSGAVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 380

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGG+ LPS+ ++E+I  S+DVI+Q  RLRDGSRRIT+I E+V
Sbjct: 381 LHANSPREAISRIESMITMGGYGLPSKTIKEMIVGSVDVIIQAARLRDGSRRITHITEVV 440

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  YE+ GEDE GK++G+H STG++RPRFW+RA  YG E+ LAE L + 
Sbjct: 441 GLEGDVIVTQDLFVYEITGEDEHGKVVGKHRSTGIARPRFWDRARYYGLERELAEALDAA 500

Query: 477 E 477
           E
Sbjct: 501 E 501


>gi|329890994|ref|ZP_08269337.1| cpaF [Brevundimonas diminuta ATCC 11568]
 gi|328846295|gb|EGF95859.1| cpaF [Brevundimonas diminuta ATCC 11568]
          Length = 427

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 282/421 (66%), Positives = 353/421 (83%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID+ QL+Q D ++A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 7   YYHATKTTIFNALMNTIDLAQLAQLDQKAASEEIRDIVAELVAIKNVSMSVAEQEHLVQD 66

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+ +VFIEV GK   T + FRDN QL+++CQRIV
Sbjct: 67  ILNDVLGYGPLEPLLARDDIADIMVNGAGRVFIEVGGKVQLTNVRFRDNGQLMNICQRIV 126

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDE+SPICDARL DGSRVNVI PPLA+DGPTLTIRKFKKDKLT+ +LV + +++
Sbjct: 127 SQVGRRVDEASPICDARLPDGSRVNVIAPPLAIDGPTLTIRKFKKDKLTMRNLVEYASIS 186

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN LT +ID  ER++TCED AELQLQQPHV
Sbjct: 187 PEGARVLGVIGASRCNLVISGGTGSGKTTLLNTLTAFIDPTERVITCEDAAELQLQQPHV 246

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G+ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 247 VRLETRPPNLEGQGQITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 306

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  RME+MI MGG+ LPS+ +RE+I  S+DVIVQ  RLRDGSRRIT+I E+V
Sbjct: 307 LHANSPREAISRMESMITMGGYGLPSKTIREMIVGSIDVIVQAARLRDGSRRITHITEVV 366

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  Y++ GED  GK+ G+H STG++RPRFW+RA  YG E+ LAE L + 
Sbjct: 367 GLEGDVIVTQDLFVYDITGEDAHGKITGRHRSTGIARPRFWDRARYYGLERELAEALDAA 426

Query: 477 E 477
           E
Sbjct: 427 E 427


>gi|167648149|ref|YP_001685812.1| type II secretion system protein E [Caulobacter sp. K31]
 gi|167350579|gb|ABZ73314.1| type II secretion system protein E [Caulobacter sp. K31]
          Length = 504

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 279/421 (66%), Positives = 353/421 (83%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +Y+  K+TIF  L+  ID++QL+Q D ++A +EI  ++ E+V++K ++MS+ EQ  L +D
Sbjct: 84  YYHATKTTIFNALLNTIDLSQLAQLDLKAAAEEIRDIVAELVAIKNVSMSVSEQEHLVQD 143

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ND+LGYGPL+PL+ARDDIADIMVNG+++VFIEV GK   T + FRDN QL+++CQRIV
Sbjct: 144 IINDVLGYGPLEPLLARDDIADIMVNGAHRVFIEVGGKVQLTNVRFRDNLQLMNICQRIV 203

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           +QVGRRVDESSPICDARL DGSRVNVI PPLALDGPTLTIRKFKKDKLT+ +LV + +++
Sbjct: 204 SQVGRRVDESSPICDARLPDGSRVNVIAPPLALDGPTLTIRKFKKDKLTMKNLVDYASIS 263

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            EGAR+L +IG  RCN++ISGGTGSGKTTLLN +T +ID  ER+VTCED AELQLQQPHV
Sbjct: 264 PEGARVLGVIGACRCNIVISGGTGSGKTTLLNTMTAFIDPTERVVTCEDAAELQLQQPHV 323

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRPPN+EG+G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGT
Sbjct: 324 VRLETRPPNLEGQGAVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGT 383

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ RE+  R+E+MI MGG+ LPS+ ++E+I  S+DVI+Q  RLRDG+RRIT+I E+V
Sbjct: 384 LHANSPREAISRIESMITMGGYGLPSKTIKEMIVGSVDVIIQAARLRDGTRRITHITEVV 443

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G+EG+VI+TQDL  YE+ GED  G ++G+H STG+ RPRFW+RA  YG E+ LAE L + 
Sbjct: 444 GLEGDVIVTQDLFVYEISGEDAAGNVVGKHRSTGIGRPRFWDRARYYGLERELAEALDAA 503

Query: 477 E 477
           E
Sbjct: 504 E 504


>gi|304320650|ref|YP_003854293.1| pilus assembly protein CpaF [Parvularcula bermudensis HTCC2503]
 gi|303299552|gb|ADM09151.1| pilus assembly protein CpaF [Parvularcula bermudensis HTCC2503]
          Length = 487

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 283/436 (64%), Positives = 353/436 (80%)

Query: 40  SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS 99
           + P AE +      ++  YY+ K  IF  LI+ ID++QL+Q D ++A +EI  ++NEI+S
Sbjct: 51  TPPQAEVKKPIVDEKSEGYYQTKMVIFNALIDTIDLSQLAQLDMEAAAEEIRDIVNEIIS 110

Query: 100 VKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETG 159
           +K + MS+ EQ  L +D+CND+LGYGPL+PL+ARDDIADIMVNG+N+ FIEV+GK  ET 
Sbjct: 111 IKGLQMSIAEQEALLQDICNDVLGYGPLEPLLARDDIADIMVNGANRTFIEVDGKIQETP 170

Query: 160 INFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKF 219
           + FRDN QL+++CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL++DGP LTIRKF
Sbjct: 171 VRFRDNAQLMNICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLSIDGPALTIRKF 230

Query: 220 KKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDER 279
           KKDKLT+D LV FG+++  GA++L IIG  R N LISGGTGSGKTTLLNC+T +ID DER
Sbjct: 231 KKDKLTIDDLVRFGSISEAGAKVLGIIGACRINTLISGGTGSGKTTLLNCMTSFIDLDER 290

Query: 280 IVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEV 339
           ++TCED AELQLQQPHVVRLETRPPN+EG+G++TMRDLVKNCLRMRPERI++GEVRG E 
Sbjct: 291 VITCEDAAELQLQQPHVVRLETRPPNLEGQGQVTMRDLVKNCLRMRPERIVVGEVRGAEA 350

Query: 340 LDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT 399
            DLLQAMNTGHDGSMGT+HAN+ RE+  R+E+MI MGG  LPS+ +RE+I  S+DV++Q 
Sbjct: 351 FDLLQAMNTGHDGSMGTLHANSPREALSRLESMITMGGLGLPSKTIREMIVGSVDVVIQA 410

Query: 400 QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            RLRDGSRRIT+I E++G EG+ IITQDL  Y + GED  GK+IG H STG++RP FW+R
Sbjct: 411 ARLRDGSRRITHITEVLGTEGDTIITQDLFVYNMDGEDADGKIIGAHRSTGIARPAFWDR 470

Query: 460 AAQYGEEKNLAEVLQS 475
           A  YG    LAE L +
Sbjct: 471 ARYYGRHHELAEALDA 486


>gi|83312843|ref|YP_423107.1| Flp pilus assembly protein, ATPase CpaF [Magnetospirillum
           magneticum AMB-1]
 gi|82947684|dbj|BAE52548.1| Flp pilus assembly protein, ATPase CpaF [Magnetospirillum
           magneticum AMB-1]
          Length = 462

 Score =  589 bits (1518), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 284/473 (60%), Positives = 358/473 (75%), Gaps = 16/473 (3%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE 60
           MFGRR      S   +  +  P+E   +++         ++P A+   G          +
Sbjct: 1   MFGRR------SAPPDPKSAAPRETAKAAT---------ATPLAQPAPGRGAEPDQRLSD 45

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  IF  LI+ +D T+L + +    R+EI+ ++ EI+S++ + +S  EQ  +  D+CND
Sbjct: 46  IKIAIFNDLIDSVDPTELGKLEPAQVREEISDIVAEIISMRNLVISAAEQQVVIADICND 105

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           +LG GPL+PLIARDDIADIMVNG+ KV+IE  G+   T I FRDN QL+++CQRIV  VG
Sbjct: 106 VLGLGPLEPLIARDDIADIMVNGAGKVYIETEGRIELTDIKFRDNAQLMNICQRIVAAVG 165

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDESSPICDARL DGSRVNVI+PPLA+DGPTLTIRKFK++KLTL+ LV FG+++A  A
Sbjct: 166 RRVDESSPICDARLADGSRVNVIVPPLAIDGPTLTIRKFKREKLTLEKLVEFGSLSAPAA 225

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           R+LQI   +RCN+LISGGTGSGKTTLLNC+TRYID+ ERIVTCED AELQLQQPHVVRLE
Sbjct: 226 RVLQIASAVRCNILISGGTGSGKTTLLNCMTRYIDQTERIVTCEDAAELQLQQPHVVRLE 285

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPN+EG G +TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGTIHAN
Sbjct: 286 TRPPNLEGAGAVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTIHAN 345

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++  R+E M+AMGG++LP++ VRE I S+++VIVQ  RLRDGSR+IT+I E+VGMEG
Sbjct: 346 TPRDALSRVENMVAMGGYSLPAKAVREQIASAVNVIVQASRLRDGSRKITHITEVVGMEG 405

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
            VI  QDL  +E  GED  G+++G+H  TG+ RP FW+RA  YG E++LAE L
Sbjct: 406 EVITLQDLFVFEFEGEDSRGRILGRHRPTGL-RPAFWDRARYYGLERDLAEAL 457


>gi|23016182|ref|ZP_00055941.1| COG4962: Flp pilus assembly protein, ATPase CpaF [Magnetospirillum
           magnetotacticum MS-1]
          Length = 464

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/473 (60%), Positives = 358/473 (75%), Gaps = 14/473 (2%)

Query: 1   MFGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYE 60
           MFGRR +        E   P P+E    ++         +SPS+    G          +
Sbjct: 1   MFGRRAQP------PEKTAPPPKEAAKPAAGPVSA---PASPSS----GRTAELDQRLSD 47

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  IF  LI+ +D T+L + +    R+EI+ ++ EI+S++ + +S  EQ  +  D+CND
Sbjct: 48  IKIAIFNDLIDSVDPTELGKLEPAQVREEISDIVAEIISMRNLVISAAEQQVVIGDICND 107

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           +LG GPL+PLIARDDIADIMVNG++KV+IE  G+   T I FRDN QL+++CQRIV  VG
Sbjct: 108 VLGLGPLEPLIARDDIADIMVNGADKVYIETEGRIELTDIKFRDNAQLMNICQRIVAAVG 167

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDE+SPICDARL+DGSRVNVI+PPLA+DGPTLTIRKFK++KLTL+ LV FG+V+A  A
Sbjct: 168 RRVDEASPICDARLMDGSRVNVIVPPLAIDGPTLTIRKFKREKLTLEKLVEFGSVSAPAA 227

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           R+LQI    R N+LISGGTGSGKTTLLNC+TRYID+ ERIVTCED AELQLQQPHVVRLE
Sbjct: 228 RVLQIASASRLNILISGGTGSGKTTLLNCMTRYIDQTERIVTCEDAAELQLQQPHVVRLE 287

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPN+EG G ITMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGTIHAN
Sbjct: 288 TRPPNLEGTGAITMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTIHAN 347

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++  R+E M+AMGG++LP++ VRE I++++++IVQ  RLRDGSR+IT+I E+VGMEG
Sbjct: 348 TPRDALSRVENMVAMGGYSLPAKAVREQISAAINLIVQASRLRDGSRKITHITEVVGMEG 407

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
            VI  QDL  +E  GED  G+++G+H  TG+ RP FW+RA  YG E++LAE L
Sbjct: 408 EVITLQDLYVFEFEGEDSRGRILGRHRPTGL-RPAFWDRARYYGLERDLAEAL 459


>gi|144897214|emb|CAM74078.1| Flp pilus assembly protein, ATPase CpaF [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 446

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 265/405 (65%), Positives = 331/405 (81%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           ++K  IF  LI+ +D  +LS+ D Q+ R+EI+ ++ EI+S++ + +S  EQ  +  D+CN
Sbjct: 42  DIKVAIFNDLIDSVDPAELSRLDPQTVREEISDIVAEIISMRGLVLSAAEQQVVVTDICN 101

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+LG GPL+PLIARDDIADIMVNG+ KV+IEV G    T I FRDN QL+++CQRIV+ V
Sbjct: 102 DVLGLGPLEPLIARDDIADIMVNGAGKVYIEVAGHIQLTDIKFRDNAQLMNICQRIVSAV 161

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSPICDARL DGSRVNVI+PPLALDGPTLTIRKFK+DKLTLD L+ FG ++  G
Sbjct: 162 GRRVDESSPICDARLADGSRVNVIVPPLALDGPTLTIRKFKRDKLTLDKLIGFGTISVAG 221

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A++L+I    RCN+L+SGGTGSGKTTLLNCLTRYID+ ERIVTCED AELQLQQPHVVRL
Sbjct: 222 AKVLEIAAACRCNILVSGGTGSGKTTLLNCLTRYIDEGERIVTCEDAAELQLQQPHVVRL 281

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRPPN+EG G++TMRDLVKNCLRMRPERII+GEVRGPE  DLLQAMNTGHDGSMGTIHA
Sbjct: 282 ETRPPNLEGAGQVTMRDLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTIHA 341

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E M+AMGG+ LP++ VRE I ++++VIVQ  RLRDGSRRIT+I E++GME
Sbjct: 342 NTPRDALARVENMVAMGGYNLPAKAVREQIAAAVNVIVQASRLRDGSRRITHITEVIGME 401

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G+VI  QDL  +++ GED  G+++G H  TG+ R  FW++   +G
Sbjct: 402 GDVITLQDLFVFDMDGEDGQGRILGTHRPTGI-RSGFWDKGPYFG 445


>gi|218662451|ref|ZP_03518381.1| pilus assembly secretion ATP-binding protein [Rhizobium etli
           IE4771]
          Length = 292

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/265 (76%), Positives = 236/265 (89%)

Query: 217 RKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK 276
           RKFKKDKLTLD LV FGA+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLNCLT YID+
Sbjct: 27  RKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVIISGGTGSGKTTLLNCLTNYIDR 86

Query: 277 DERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRG 336
           DER++TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII+GEVRG
Sbjct: 87  DERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIIVGEVRG 146

Query: 337 PEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVI 396
           PEV DLLQAMNTGHDGSMGTIHAN  RE   R+E+MIAMGGFTLP++ VREII++S+DVI
Sbjct: 147 PEVFDLLQAMNTGHDGSMGTIHANTPRECLSRVESMIAMGGFTLPAKTVREIISTSVDVI 206

Query: 397 VQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRF 456
           +Q  RLRDGSRRIT I E++GMEG+VIITQDL++YE+ GED  G+LIG+H+STGV +P F
Sbjct: 207 IQAARLRDGSRRITQITEVIGMEGDVIITQDLMRYEIEGEDAGGRLIGRHMSTGVGKPHF 266

Query: 457 WNRAAQYGEEKNLAEVLQSLEKQSR 481
           W+RA  + EEK LA  L ++E +S+
Sbjct: 267 WDRARYFNEEKRLAAALDAMEAKSK 291


>gi|85707900|ref|ZP_01038966.1| pilus assembly protein CpaF [Erythrobacter sp. NAP1]
 gi|85689434|gb|EAQ29437.1| pilus assembly protein CpaF [Erythrobacter sp. NAP1]
          Length = 516

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/430 (50%), Positives = 300/430 (69%), Gaps = 4/430 (0%)

Query: 43  SAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKK 102
           +AE E G F       +++K  +   L+E +D    +    +   +E   ++ E+++  K
Sbjct: 89  AAESEAGGF---EASVHKIKEQVLPRLLERVDPEAAATLTKEELSEEFRPIIMEVLAELK 145

Query: 103 ITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINF 162
           +T++  EQ  L + L +++LG+GPL+ L+   D++DIMVNG ++ +IE  GK V   I F
Sbjct: 146 VTLNRREQFALEKVLIDELLGFGPLEELLNDPDVSDIMVNGPDQTYIEKKGKLVIAPIRF 205

Query: 163 RDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKD 222
           RD + L  + QRIVNQVGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF + 
Sbjct: 206 RDEQHLFQIAQRIVNQVGRRVDQTTPLADARLKDGSRVNVIVPPLSLRGTAISIRKFSEK 265

Query: 223 KLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVT 282
            +TLD L  FG+++ +    L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER++T
Sbjct: 266 PITLDMLKEFGSMSEKMCTALKIAGACRMNIVISGGTGSGKTTMLNALSKMIDPGERVLT 325

Query: 283 CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDL 342
            ED AEL+LQQPH + LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DL
Sbjct: 326 IEDAAELRLQQPHWLPLETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDL 385

Query: 343 LQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRL 402
           L AMNTGHDGSM T+HAN+ RE  GRME MI MG   +P + +   I  S+D+IVQ +RL
Sbjct: 386 LAAMNTGHDGSMCTLHANSPRECLGRMENMILMGDIKIPKEAISRQIAESVDLIVQVKRL 445

Query: 403 RDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQ 462
           RDGSRR TNI E++GMEG+VI+TQ+L K+E + E E GK++G+  S+G+ RP    +A Q
Sbjct: 446 RDGSRRTTNITEVIGMEGDVIVTQELFKFEYLDESEDGKIMGEFRSSGL-RPYTLEKARQ 504

Query: 463 YGEEKNLAEV 472
           +G ++   E 
Sbjct: 505 FGFDQAYLEA 514


>gi|218507368|ref|ZP_03505246.1| pilus assembly secretion ATP-binding protein [Rhizobium etli Brasil
           5]
          Length = 336

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/251 (82%), Positives = 229/251 (91%)

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           IEV GKT+E+ I FRDN QLLS+CQRIV+QVGRRVDESSPICDARL DGSRVNVI PPL+
Sbjct: 1   IEVGGKTIESEIRFRDNAQLLSICQRIVSQVGRRVDESSPICDARLPDGSRVNVIAPPLS 60

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           +DGP LTIRKFKKDKLTLD LV FGA+T EGA +LQIIGR+RCNV+ISGGTGSGKTTLLN
Sbjct: 61  IDGPALTIRKFKKDKLTLDQLVRFGAITPEGATVLQIIGRVRCNVVISGGTGSGKTTLLN 120

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
           CLT YID+DER++TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER
Sbjct: 121 CLTNYIDRDERVITCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 180

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           II+GEVRGPEV DLL AMNTGHDGSMGTIHAN  RE   R+ +MIAMGGFTLP++ VREI
Sbjct: 181 IIVGEVRGPEVFDLLHAMNTGHDGSMGTIHANTPRECLSRIGSMIAMGGFTLPAKTVREI 240

Query: 389 ITSSLDVIVQT 399
           I++S+DVI+Q 
Sbjct: 241 ISTSVDVIIQA 251


>gi|219850071|ref|YP_002464504.1| type II secretion system protein E [Chloroflexus aggregans DSM
           9485]
 gi|219544330|gb|ACL26068.1| type II secretion system protein E [Chloroflexus aggregans DSM
           9485]
          Length = 463

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/402 (52%), Positives = 294/402 (73%), Gaps = 2/402 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+++ +   LI  ++ +Q+   +    R ++  + N I+  + I +S  E+  LFE +
Sbjct: 43  FRELRARVQDRLINELN-SQIDLNNQAKVRKQVEEIFNSILDSESIVLSRAERQRLFESI 101

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             DI+G GPL+PL+A DD+++IMVNG  +V+IE  GK ++T I F D++ ++ +  RIV 
Sbjct: 102 TADIIGLGPLEPLLADDDVSEIMVNGPKQVYIEKKGKLIKTDITFADDDHVMRIIDRIVA 161

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRRVDESSP+ DARL DGSRVNV+I PLAL+GPT+TIRKF+KDKLT+  LV FG+++ 
Sbjct: 162 PLGRRVDESSPMVDARLKDGSRVNVVIRPLALNGPTITIRKFRKDKLTVQDLVRFGSMSQ 221

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A  L    + R N++++GGTGSGKTTLLN L+ +I +DERI+T E+ AELQL+Q HVV
Sbjct: 222 DMADFLAACVQARLNIVVAGGTGSGKTTLLNVLSSFIPEDERIITVENAAELQLRQEHVV 281

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE+RPPN+EG+GE+T+RDLV NCLRMRPERII+GE RG E LD+LQAMNTGHDGSM TI
Sbjct: 282 TLESRPPNVEGKGEVTIRDLVINCLRMRPERIIVGECRGGETLDMLQAMNTGHDGSMTTI 341

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E M  M G  LP++ +RE I S++ V VQ  RL+DGSR++T I E+ G
Sbjct: 342 HANSPRDAVSRIETMCLMAGMDLPARAIREQIASAIHVFVQQSRLKDGSRKVTQITEVAG 401

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
           MEG+V++ QD+  +E  G DE GK++G    TGV RPRF  +
Sbjct: 402 MEGDVVVLQDIFVFEQTGIDEKGKIVGHLRPTGV-RPRFLEK 442


>gi|149185936|ref|ZP_01864251.1| pilus assembly protein CpaF [Erythrobacter sp. SD-21]
 gi|148830497|gb|EDL48933.1| pilus assembly protein CpaF [Erythrobacter sp. SD-21]
          Length = 479

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/460 (47%), Positives = 308/460 (66%), Gaps = 11/460 (2%)

Query: 20  PLPQEVVVSSSNIQKQNLQS-------SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEM 72
           PLP E   +       +  S       ++  +EGE+G F       +++K  +   L+E 
Sbjct: 22  PLPAEGASAPGRATSNDAMSRLDERMNATHQSEGEVGGF---EASVHKIKEQVLPRLLER 78

Query: 73  IDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIA 132
           +D    +        +E   ++ E+++  K+T++  EQ  L + L +++LG+GPL+ L+ 
Sbjct: 79  VDPEAAATLTKDELSEEFRPIIMEVLAELKVTLNRREQFALEKVLIDELLGFGPLEELLN 138

Query: 133 RDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDA 192
             DI+DIMVNG ++ ++E  GK     I FRD + L  + QRIVNQVGRRVD+++P+ DA
Sbjct: 139 DPDISDIMVNGPDQTYVEKKGKLQIAPIRFRDEQHLFQIAQRIVNQVGRRVDQTTPLADA 198

Query: 193 RLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCN 252
           RL DGSRVNVI+PPL+L G  L+IRKF +  +TLD L  FG+++ +    L+I G  R N
Sbjct: 199 RLKDGSRVNVIVPPLSLRGTALSIRKFSEKPITLDMLQGFGSMSEKMCTALKIAGACRMN 258

Query: 253 VLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEI 312
           ++ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + LETRPPN+EG+G I
Sbjct: 259 IVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLPLETRPPNLEGQGAI 318

Query: 313 TMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAM 372
           T+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+HAN+ RE  GRME M
Sbjct: 319 TIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLHANSPRECLGRMENM 378

Query: 373 IAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE 432
           I MG   +P + +   I  S+D+IVQ +RLRDGSRR T+I E++GMEG+VI+TQ+L K+E
Sbjct: 379 ILMGDIKIPKEAISRQIAESVDLIVQVKRLRDGSRRTTDITEVIGMEGDVIVTQNLFKFE 438

Query: 433 VMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
            + E E GK++G+  S+G+ RP    +A Q+G ++   E 
Sbjct: 439 YLDESEDGKILGEFRSSGL-RPYTLEKARQFGFDQAYLEA 477


>gi|163846105|ref|YP_001634149.1| type II secretion system protein E [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523840|ref|YP_002568310.1| type II secretion system protein E [Chloroflexus sp. Y-400-fl]
 gi|163667394|gb|ABY33760.1| type II secretion system protein E [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447719|gb|ACM51985.1| type II secretion system protein E [Chloroflexus sp. Y-400-fl]
          Length = 465

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/402 (52%), Positives = 293/402 (72%), Gaps = 2/402 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E++S +   LI  ++  Q+   +    R ++  + N I+  + I +S  E+  LFE +
Sbjct: 45  FRELRSRVQDRLINELN-PQIDLSNPAKVRKQVEEIFNAILDSESIVLSRTERQRLFESI 103

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             DI+G GP++PL+A +D+++IMVNG  +V+IE  GK ++T I F D++ ++ +  RIV 
Sbjct: 104 TADIIGLGPIEPLLADEDVSEIMVNGPKQVYIEKKGKLIKTDITFTDDDHVMRIIDRIVA 163

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRRVDESSP+ DARL DGSRVNV+I PLAL+GPT+TIRKF+KDKLT+  LV FG+++ 
Sbjct: 164 PLGRRVDESSPMVDARLKDGSRVNVVIRPLALNGPTITIRKFRKDKLTVQDLVRFGSMSQ 223

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A  L    + R N++++GGTGSGKTTLLN L+ +I +DERI+T E+ AELQL+Q HVV
Sbjct: 224 DMADFLAACVQARLNIVVAGGTGSGKTTLLNVLSSFIPEDERIITVENAAELQLRQDHVV 283

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE+RPPN+EG+GE+T+RDLV NCLRMRPERII+GE RG E LD+LQAMNTGHDGSM TI
Sbjct: 284 TLESRPPNVEGKGEVTIRDLVINCLRMRPERIIVGECRGGETLDMLQAMNTGHDGSMTTI 343

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M  M G  LP++ +RE I S++ V VQ  RL+DGSR++T I E+ G
Sbjct: 344 HANTPRDAVSRIETMCLMAGMDLPARAIREQIASAIHVFVQQSRLKDGSRKVTQITEVAG 403

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
           MEG+V++ QD+  +E  G DE GK++GQ   TGV RPRF  +
Sbjct: 404 MEGDVVVLQDIFVFEQTGIDEKGKIVGQLRPTGV-RPRFLEK 444


>gi|85373310|ref|YP_457372.1| pilus assembly protein CpaF [Erythrobacter litoralis HTCC2594]
 gi|84786393|gb|ABC62575.1| pilus assembly protein CpaF [Erythrobacter litoralis HTCC2594]
          Length = 495

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 297/426 (69%), Gaps = 4/426 (0%)

Query: 47  EIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMS 106
           EIG F       +++K  +   L+E +D    +    +   +E   ++ E+++  K+T++
Sbjct: 72  EIGGF---EASVHKIKEQVLPRLLERVDPEAAATLSKEELSEEFRPIIMEVLAELKVTLN 128

Query: 107 LDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNE 166
             EQ  L + L +++LG+GPL+ L+   D++DIMVNG ++ +IE  GK V   I FRD  
Sbjct: 129 RREQFALEKVLIDELLGFGPLEELLQDPDVSDIMVNGPDQTYIEKKGKLVLAPIQFRDES 188

Query: 167 QLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTL 226
            L  + QRIVNQVGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF +  +TL
Sbjct: 189 HLFQIAQRIVNQVGRRVDQTTPLADARLKDGSRVNVIVPPLSLRGTAISIRKFSEKPITL 248

Query: 227 DHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT 286
           D L  FG+++ +    L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER++T ED 
Sbjct: 249 DMLKDFGSMSDKMCTALKIAGACRMNIVISGGTGSGKTTMLNALSKMIDPGERVLTIEDA 308

Query: 287 AELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAM 346
           AEL+LQQPH + LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AM
Sbjct: 309 AELRLQQPHWLPLETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAM 368

Query: 347 NTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS 406
           NTGHDGSM T+HAN+ RE  GRME MI MG   +P + +   I  S+D+IVQ +RLRDGS
Sbjct: 369 NTGHDGSMCTLHANSPRECLGRMENMILMGDIKIPKEAISRQIAESVDLIVQVKRLRDGS 428

Query: 407 RRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           RR T+I E++GMEG+VI+TQ+L K+E + E E GK++G+  S+G+ RP    +A Q+G +
Sbjct: 429 RRTTDITEVIGMEGDVIVTQNLFKFEYLDESEDGKILGEFRSSGL-RPYTLEKARQFGFD 487

Query: 467 KNLAEV 472
           +   E 
Sbjct: 488 QAYLEA 493


>gi|218887824|ref|YP_002437145.1| type II secretion system protein E [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758778|gb|ACL09677.1| type II secretion system protein E [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 624

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/412 (51%), Positives = 289/412 (70%), Gaps = 3/412 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLF 114
           HYYE+++ +   L+EM+D+             EI+ L+ +++    ++  ++  EQ  L 
Sbjct: 202 HYYEIRARLQDRLLEMMDLAAAESLPPDRLAAEISRLVEKLLREEFRQAPLNAQEQRQLV 261

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           ED+ ++++G GPL+PL+    + DI+VN    V++E  GK +     F D++ L  +  R
Sbjct: 262 EDIRDEVMGLGPLEPLLRDPTVNDILVNNYRMVYVERRGKLIRVNTRFLDDDHLRKIIDR 321

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV ++GRRVDE+SP+ DARL DGSRVN IIPPLALDGP+L+IR+F KD L L+ L+ FGA
Sbjct: 322 IVARIGRRVDEASPMVDARLADGSRVNAIIPPLALDGPSLSIRRFSKDPLELEDLIRFGA 381

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T E   +L+ I + R N+++SGGTGSGKTT+LNCL+R++  DERIVT ED AELQL+Q 
Sbjct: 382 LTPEMGEVLRGIVKARLNIIVSGGTGSGKTTMLNCLSRFVPHDERIVTIEDAAELQLKQD 441

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRP NIEG G++T RDLVKNCLRMRP+RII+GEVR  EVLD+LQAMNTGHDGS+
Sbjct: 442 HVVRLETRPANIEGHGQVTARDLVKNCLRMRPDRIIVGEVRSGEVLDMLQAMNTGHDGSL 501

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN  R+   R+E M+AM G  + +  ++  I S++DVI+Q  RL DGSR++T++ E
Sbjct: 502 TTIHANTPRDCLMRLETMVAMAGLNIGTLSLKRYIASAVDVIIQVSRLADGSRKMTSLSE 561

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           I GMEG+ I  QD+  +E  G DE GK+ G+  S G+ RPRF  R A  G E
Sbjct: 562 ITGMEGDAITMQDIFTFEQTGVDENGKVQGRFRSGGI-RPRFAPRLAAMGIE 612


>gi|162147493|ref|YP_001601954.1| type II/IV secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545600|ref|YP_002277829.1| type II secretion system protein E [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786070|emb|CAP55652.1| Type II/IV secretion system protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533277|gb|ACI53214.1| type II secretion system protein E [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 478

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/390 (51%), Positives = 284/390 (72%), Gaps = 1/390 (0%)

Query: 88  DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           +E+  ++ +  S ++I ++L EQ ++  +L +D+LG GP+QPL+  + I+DI++NG N++
Sbjct: 90  EEVERVVGQAASERRIQLNLREQREIATELVHDMLGLGPIQPLLDDETISDILINGPNRI 149

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           F+E  GKTV + + FRD + L+SV QRI + VGRRVDESSP  DARL DGSRVN++ PPL
Sbjct: 150 FVERRGKTVLSNVRFRDVDHLVSVSQRIASAVGRRVDESSPTVDARLKDGSRVNIVFPPL 209

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           ALDGP ++IRKF K  +    LV  G+ T + A++L+I GR+R N++ISGGTGSGKTTL+
Sbjct: 210 ALDGPYVSIRKFSKRPINFSRLVENGSCTPKLAKILEIAGRVRLNIVISGGTGSGKTTLM 269

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           N ++ +ID DER++T ED AELQLQQPHVVRLETRPP+IEG+GE+T RDLV+N LRMRP+
Sbjct: 270 NAVSHFIDFDERVITVEDAAELQLQQPHVVRLETRPPSIEGKGEVTQRDLVRNALRMRPD 329

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RII+GEVRG E  D+LQAMNTGHDGSM TIHAN  R++  R+E M+ MG F LP+  +R 
Sbjct: 330 RIIIGEVRGAEAFDMLQAMNTGHDGSMSTIHANTTRDAVTRIENMVQMGSFGLPTTAIRT 389

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHI 447
            I  ++D+IVQ  R RDG RRI  + ++ G+EG+V++  D+  +   GED  G+L G++ 
Sbjct: 390 QIVGAVDMIVQVGRHRDGGRRIVQVTDVSGLEGDVVVLNDIFNFVFDGEDMDGRLHGRYE 449

Query: 448 STGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
            + + RP F+++   Y  ++      + LE
Sbjct: 450 ESKI-RPSFFDKLKYYELDRAWYAAFEELE 478


>gi|296284373|ref|ZP_06862371.1| pilus assembly protein CpaF [Citromicrobium bathyomarinum JL354]
          Length = 504

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/414 (50%), Positives = 292/414 (70%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E ID    S        +E   ++ E+++  KIT++  EQ  L + L 
Sbjct: 90  HKIKEQVLPRLLERIDPEAASTLTKDELAEEFRPIIMEVLAELKITLNRREQFALEKVLI 149

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG+GPL+ L+   D++DIMVNG ++ +IE  GK     I FRD + L  + QRIVNQ
Sbjct: 150 DELLGFGPLEELLTDPDVSDIMVNGPDQTYIEKKGKLQIAPIQFRDEQHLFQIAQRIVNQ 209

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF +  +T+D L ++G++  +
Sbjct: 210 VGRRVDQTTPLADARLKDGSRVNVIVPPLSLRGTAISIRKFSEKPITIDMLKNWGSMDDK 269

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A  L++ G  R NV+ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 270 MATALKVAGACRMNVVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLP 329

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 330 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAEAFDLLAAMNTGHDGSMCTLH 389

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+ RE+ GRME MI MG   +P + +   I  S+D+IVQ +RLRDGSRR TNI E++GM
Sbjct: 390 ANSPREALGRMENMILMGDIKIPKEAISRQIAESVDLIVQVKRLRDGSRRTTNITEVIGM 449

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG VI+TQ+L K+E + E E GK+ G+  S+G+ RP    +A Q+G ++   E 
Sbjct: 450 EGEVIVTQELFKFEYLEEGEDGKIKGEFRSSGL-RPYTLEKARQFGFDQAYLEA 502


>gi|87199873|ref|YP_497130.1| type II secretion system protein E [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135554|gb|ABD26296.1| type II secretion system protein E [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 521

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/414 (50%), Positives = 291/414 (70%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +        +E   ++ E+++  K+T++  EQ  L + L 
Sbjct: 107 HKIKEQVLPRLLERVDPEAAATLTKDELSEEFRPIIMEVLAELKVTLNRREQFALEKVLI 166

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG+GPL+ L+   D++DIMVNG  + +IE  GK     I FRD   L  + QRIVNQ
Sbjct: 167 DELLGFGPLEELLNDPDVSDIMVNGPEQTYIEKKGKLQLAPIRFRDESHLFQIAQRIVNQ 226

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF +  +T+D L  FG+++ +
Sbjct: 227 VGRRVDQTTPLADARLKDGSRVNVIVPPLSLRGTAISIRKFSEKPITIDMLRDFGSMSDK 286

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A  L+I G  R NV+ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 287 MATCLKIAGASRMNVVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLP 346

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 347 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLH 406

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+ RE  GRME MI MG   +P + +   I  S+D+IVQ +RLRDGSRR TNI E++GM
Sbjct: 407 ANSPRECLGRMENMILMGDIKIPKEAISRQIAESVDLIVQVKRLRDGSRRTTNITEVIGM 466

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG+VI+TQ+L K+E + E + GK+IG+  S+G+ RP    +A Q+G ++   E 
Sbjct: 467 EGDVIVTQELFKFEYLDETDEGKIIGEFRSSGL-RPYTLEKARQFGFDQAYLEA 519


>gi|27378605|ref|NP_770134.1| component of type IV pilus [Bradyrhizobium japonicum USDA 110]
 gi|27351753|dbj|BAC48759.1| component of type IV pilus [Bradyrhizobium japonicum USDA 110]
          Length = 458

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/475 (45%), Positives = 310/475 (65%), Gaps = 20/475 (4%)

Query: 2   FGRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEV 61
           FGRRD          D+ P P   V          L +S+PS           T H   +
Sbjct: 4   FGRRD----------DDTPAPLPAVTP--------LPASTPSLPASAPRQAPST-HRPLM 44

Query: 62  KSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDI 121
            +++   +IE ID +  +       R +I  +++ I + +++ +S  EQ+ L +++ +D+
Sbjct: 45  PASLRERVIEQIDPSVAATVSRDVLRRQIEEIIHGIANEERLELSGREQIQLADEIADDM 104

Query: 122 LGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGR 181
            GYGPL+PL+    I DIMVNG + V++E +G+     + FRDN+ + SV Q+I  QVGR
Sbjct: 105 TGYGPLRPLLLDQSINDIMVNGPSNVYVERSGRLERIAVRFRDNDHIASVAQKIAAQVGR 164

Query: 182 RVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGAR 241
           RVDESSP+ D RLLDGSRVN+I+PPLA+  P ++IRKF   +L +  L+  G++TA   +
Sbjct: 165 RVDESSPMVDCRLLDGSRVNIILPPLAIHSPCISIRKFPSLRLDMAGLIENGSMTAAIGQ 224

Query: 242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLET 301
           LL++  R R NVL+SGGTGSGKTTLLN +++YID  ERIVT ED AELQLQQPHVV LET
Sbjct: 225 LLEVAARSRLNVLVSGGTGSGKTTLLNAMSQYIDHSERIVTIEDAAELQLQQPHVVSLET 284

Query: 302 RPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANN 361
           RPP++EG G++T RDL+ N LRMRP+RI++GEVRG E  D+LQAMNTGHDGS+ T+HAN+
Sbjct: 285 RPPSLEGTGQVTQRDLLWNALRMRPDRIVVGEVRGAEAFDMLQAMNTGHDGSISTVHANS 344

Query: 362 ARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGN 421
            R++  R+E M+ MG   LPS+ +R  I ++LD+IVQ +R+RDG RRI  I E++G+EG+
Sbjct: 345 TRDALTRIENMVQMGQVNLPSRAIRTQIVAALDLIVQVERMRDGQRRIIQISEVIGLEGD 404

Query: 422 VIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           VI T D+  +E   ED  G+L G +    ++ P+F +R   YG +   AE ++ +
Sbjct: 405 VITTNDIAAFEYQDEDVHGRLSGTY-RCNLATPKFKSRLVYYGLDGAWAEAMRQI 458


>gi|326387710|ref|ZP_08209316.1| type II secretion system protein E [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207756|gb|EGD58567.1| type II secretion system protein E [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 489

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/414 (50%), Positives = 291/414 (70%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +    +   +E   ++ E+++  K+T++  EQ  L + L 
Sbjct: 75  HKIKEQVLPHLLERVDPEAAATLTKEELSEEFRPIIMEVLAELKVTLNRREQFALEKVLI 134

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG+GPL+ L+   D++DIMVNG  + +IE  GK     I FRD   L  + QRIVNQ
Sbjct: 135 DELLGFGPLEELLNDPDVSDIMVNGPEQTYIEKKGKLQLAPIRFRDEAHLFQIAQRIVNQ 194

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF +  +TLD L  FG+++ +
Sbjct: 195 VGRRVDQTTPLADARLKDGSRVNVIVPPLSLRGTAISIRKFSEKPITLDMLRDFGSMSDK 254

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
               L+I G  R N++ISGGTGSGKTT+LN +++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 255 MCTALKIAGACRMNIVISGGTGSGKTTMLNAMSKMIDPGERVLTIEDAAELRLQQPHWLP 314

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 315 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLH 374

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+ RE  GRME MI MG   +P + +   I  S+D+IVQ +RLRDGSRR TN+ E++GM
Sbjct: 375 ANSPRECLGRMENMILMGDIKIPKEAISRQIAESVDLIVQVKRLRDGSRRTTNVTEVIGM 434

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG+VI+TQ+L ++E + E E GK+IG+  S+G+ RP    +A Q+G ++   E 
Sbjct: 435 EGDVIVTQELFRFEYLDESEDGKIIGEFRSSGL-RPYTLEKARQFGFDQAYLEA 487


>gi|168702879|ref|ZP_02735156.1| secretion system protein TadA [Gemmata obscuriglobus UQM 2246]
          Length = 462

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/425 (49%), Positives = 299/425 (70%), Gaps = 5/425 (1%)

Query: 40  SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS 99
           SSPS  G  G   N    + E+K  I + L+E +D T++    S + R +I  ++  +  
Sbjct: 27  SSPSMAGPGGGGKN----FDELKRQIHSKLVERLDFTRVKDLSSDAMRRDIRRVIEHLCD 82

Query: 100 VKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETG 159
            +   ++  E+  L E++ ++ LG+GPL+ L+    I+DI+VNG +K ++E  GK  +T 
Sbjct: 83  TENPLLNRIEREKLIEEVLDETLGFGPLEVLLKDPTISDILVNGPHKCYVERRGKLEKTD 142

Query: 160 INFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKF 219
           + FRDN+ L+ +  RIV+++GRRVDE+SP+ DARL DGSRVN +IPP+ALDGP+L+IR+F
Sbjct: 143 VKFRDNDHLMQIIDRIVSKIGRRVDETSPMVDARLPDGSRVNAVIPPIALDGPSLSIRRF 202

Query: 220 KKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDER 279
             + L L+ L+++ A T E A L++   + R NVLISGGTG GKTTLLN L+ +I  DER
Sbjct: 203 GANPLKLEDLLNYKAFTPEMAMLMEACIKARLNVLISGGTGCGKTTLLNTLSSFIPGDER 262

Query: 280 IVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEV 339
           +VT ED AELQLQQ HVVRLETRPPNIEG+G ++ RD V+N LRMRPERII+GEVRG E 
Sbjct: 263 VVTIEDAAELQLQQDHVVRLETRPPNIEGKGAVSTRDCVRNALRMRPERIIIGEVRGSEA 322

Query: 340 LDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT 399
           LD+LQAMNTGH GS+ T+HAN  RE+  R+E MI MGGF LP + +R+ I+S++D+I+Q 
Sbjct: 323 LDMLQAMNTGHGGSLATLHANTPREALTRLETMIMMGGFELPVKAMRQQISSAIDLIIQA 382

Query: 400 QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            RL+ G R+IT+I E++ ME ++II Q++ +Y+ +G D+ G+  GQ  +TGV RP F NR
Sbjct: 383 NRLQGGPRKITHITEVMNMEQDIIIMQEVFRYKQLGIDQNGRAYGQFEATGV-RPTFINR 441

Query: 460 AAQYG 464
               G
Sbjct: 442 LESKG 446


>gi|148974882|ref|ZP_01811862.1| TadA [Vibrionales bacterium SWAT-3]
 gi|145965391|gb|EDK30640.1| TadA [Vibrionales bacterium SWAT-3]
          Length = 421

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 298/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D   L +  +Q   +++   +N ++  K++ +S  +++DL + L
Sbjct: 8   YIQLRDEIFDAL----DAASLVEISNQELEEQLKDSVNILIDKKQLQVSSLKRVDLVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEQSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARL+DGSRVN++IPPLA+DG +++IRKFK+ K+ L++L  FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLMDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLAEFGAMSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGEGERIVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP   +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARTESMVMMATASLPIFAIRRTIVSAVDLIVQVKRLHDGSRKVMYISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +YE   + + GK++G+  + G+S R   + RA  +G E+ + E+ 
Sbjct: 364 MEGDSVVMEDIFRYEASSDFKDGKMVGEFRTPGLSTRSVIYERAKFFGLEQAVREIF 420


>gi|103487771|ref|YP_617332.1| type II secretion system protein E [Sphingopyxis alaskensis RB2256]
 gi|98977848|gb|ABF53999.1| type II secretion system protein E [Sphingopyxis alaskensis RB2256]
          Length = 498

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/452 (46%), Positives = 305/452 (67%), Gaps = 3/452 (0%)

Query: 21  LPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQ 80
           +P  +      +++ N +S++ + E E       + H  ++K  +   L+E +D    + 
Sbjct: 48  MPSNLSPEGEAMERLNQRSTAEAVEPEKAQGFEASVH--KIKEQVLPRLLERVDPEAAAT 105

Query: 81  YDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIM 140
                  +E   ++ E+++  +IT++  EQ  L + L +++LG+GPL+ L+A  DI+DIM
Sbjct: 106 LSKDELTEEFRPIILEVLAELRITLNRREQFALEKVLVDELLGFGPLEELLADPDISDIM 165

Query: 141 VNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRV 200
           VNG  + ++E  G+ V   I FRD + L  + QRI N VGRRVD+++P+ DARL DGSRV
Sbjct: 166 VNGPYQTYVERKGQLVLAPIQFRDEQHLFQIAQRICNLVGRRVDQTTPLADARLKDGSRV 225

Query: 201 NVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTG 260
           NVI+PPL+L G  ++IRKF    +TLD L  +GA++ +    L+I G  R N++ISGGTG
Sbjct: 226 NVIVPPLSLRGTAISIRKFSAKPITLDMLCQWGAMSQKMCTALKIAGASRFNIVISGGTG 285

Query: 261 SGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKN 320
           SGKTT+LN L++ ID  ER++T ED AEL+LQQPH + LETRP N+EG G I M DLVKN
Sbjct: 286 SGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLPLETRPANLEGNGAIHMGDLVKN 345

Query: 321 CLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTL 380
            LRMRP+RII+GEVRG E  DLL AMNTGHDGSM T+H+N+ RE  GRME M+ MG   +
Sbjct: 346 ALRMRPDRIIMGEVRGAECFDLLAAMNTGHDGSMCTLHSNSPRECLGRMENMVLMGDIKI 405

Query: 381 PSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETG 440
           P + + + I  S+D+IVQ +RLRDGSRR+TNI E++GMEG+VI+TQ+L K+E + ED+ G
Sbjct: 406 PKEAISKQIADSVDLIVQIKRLRDGSRRVTNITEVIGMEGDVIVTQELFKFEYLDEDKDG 465

Query: 441 KLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           K++G++ S G+ RP    +A QYG ++   E 
Sbjct: 466 KIVGEYRSMGL-RPYTLEKARQYGFDQPYLEA 496


>gi|302343416|ref|YP_003807945.1| type II secretion system protein E [Desulfarculus baarsii DSM 2075]
 gi|301640029|gb|ADK85351.1| type II secretion system protein E [Desulfarculus baarsii DSM 2075]
          Length = 456

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 293/411 (71%), Gaps = 1/411 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   + E+K  +   +I+ +D+ Q+SQ    S   E+   + +++  + + ++ DE+  L
Sbjct: 27  RQAAFQELKGRMHYKVIDKVDLAQISQAADGSMDKELEGAIAQVLEGESVQLAPDERARL 86

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             ++ ++++G GPL+PL+A + +++IM NG N+V++E  G+  +    FRD+  LL +  
Sbjct: 87  IIEIKDEVMGLGPLEPLLADESVSEIMCNGYNRVYVERCGRLTKATARFRDDAHLLKIID 146

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +I  +VGRR+DESSP+ DARL DGSRVN IIPPLALDGP+LTIRKF KD LT+  L+ +G
Sbjct: 147 KIATKVGRRIDESSPMVDARLADGSRVNAIIPPLALDGPSLTIRKFAKDPLTVADLIRYG 206

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           ++T E A++++ +   R NV+ISGGTGSGKTTLLN  + +I   ERIVT ED+AELQLQQ
Sbjct: 207 SITPELAQVIKGVVTARLNVVISGGTGSGKTTLLNVFSSFIPFGERIVTIEDSAELQLQQ 266

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HVVRLETRPPNIEG G++TMRDLV+NCLRMRP+RI++GE RG E LD++QAM+TGHDGS
Sbjct: 267 EHVVRLETRPPNIEGVGQVTMRDLVRNCLRMRPDRIVVGECRGGEALDMMQAMSTGHDGS 326

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + TIHAN+ R+   RME +++MGG  +  + +R  I S+++VIVQ  RL DGSR++ +  
Sbjct: 327 LTTIHANSPRDCVSRMETLVSMGGLDISERAIRRQIASAVEVIVQVARLSDGSRKVISFS 386

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EI GMEG+++  Q++ K++  G DE GK+IG    TG+ RP F  +   +G
Sbjct: 387 EITGMEGDMVTMQEIFKFQQSGVDEKGKVIGHFGPTGI-RPSFSEKLKSHG 436


>gi|197106461|ref|YP_002131838.1| pilus assembly protein CpaF cpaF [Phenylobacterium zucineum HLK1]
 gi|196479881|gb|ACG79409.1| pilus assembly protein CpaF cpaF [Phenylobacterium zucineum HLK1]
          Length = 466

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/414 (53%), Positives = 295/414 (71%), Gaps = 1/414 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E    +   +++ ID    S+ +      E++ ++ E+ +  K+ ++  EQ +L + L N
Sbjct: 53  EAARAVQPLVLQRIDSEAASRLERPELGRELSGVVAELAAELKLQLNQREQGELVDLLLN 112

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+LG GPL+PL+A + + DIMVNG  ++++E  GK   TG  FRDN  +++V  RIV+QV
Sbjct: 113 DMLGLGPLEPLLADEAVTDIMVNGPKQIYVERKGKLTLTGARFRDNAHVMAVAGRIVSQV 172

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVN+IIPPLA+DGP+++IRKF K ++ LD +   G ++ E 
Sbjct: 173 GRRVDESSPLVDARLADGSRVNIIIPPLAIDGPSISIRKFSKRRIDLDLMARQGNLSPEM 232

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A +L+I  R R N+LISGGTGSGKTTLLN L++ I  DER+VT ED AELQLQQPHVVRL
Sbjct: 233 ATVLKIASRSRLNILISGGTGSGKTTLLNALSQMIAADERVVTIEDAAELQLQQPHVVRL 292

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N+EG GEITMR+LVKN LRMRP+RIILGE+RG E LD+LQAMNTGHDGS+GTIHA
Sbjct: 293 ETRPANLEGRGEITMRELVKNALRMRPDRIILGEIRGGEALDMLQAMNTGHDGSLGTIHA 352

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  RE+  R+E M+ M G  LP+Q VR  I +++ +IVQ  R+RDG RR+T+I E+VGME
Sbjct: 353 NRPREALTRLENMVGMSGVALPAQAVRTQIAAAVHLIVQISRMRDGVRRVTSITEVVGME 412

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           G VI  Q+L  Y   GE   G L G+  S G+ RP F +RA  +G ++ L E +
Sbjct: 413 GEVITNQELFAYRFEGEGADGMLKGRFESAGL-RPHFASRAEYFGLDRLLLEAV 465


>gi|78186667|ref|YP_374710.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166569|gb|ABB23667.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 472

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 285/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           YY  K  +   L+  ID+  +     +  R+E+  L+   +    I ++ +E+  L  DL
Sbjct: 54  YYATKKKLHQQLLTRIDLNSIETMTPEQLRNELGVLLLAQIEEDAIPLNHEERARLVSDL 113

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N+I+G GPL+PL+A   I++IMVNG   V++E +G+   T + F D+  L+ +  +IV+
Sbjct: 114 KNEIMGLGPLEPLLADAAISEIMVNGYQNVYVESSGRIELTDVRFNDDAHLMKIIDKIVS 173

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPPLALDGP LTIR+F    L +  L+    +T 
Sbjct: 174 RVGRRIDESSPMVDARLPDGSRVNAIIPPLALDGPVLTIRRFSVVPLEMKDLIEKNTLTP 233

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + +++CN+LISGGTGSGKTTLLN L+ YI  +ERIVT EDTAELQLQQ HV+
Sbjct: 234 AMAELLSALVKVKCNILISGGTGSGKTTLLNILSGYIPHNERIVTIEDTAELQLQQDHVI 293

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+ EITMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTGHDGS+ T+
Sbjct: 294 RLETRPPNIEGKAEITMRALVKNTLRMRPDRIVLGEVRSAEVIDMLQAMNTGHDGSLTTV 353

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R+S  R+E ++ MGG +LP + +R++I+SS+  IVQ  R  DGSR+IT+I EI+G
Sbjct: 354 HANSPRDSLARLENLVGMGGLSLPGKALRQLISSSIHFIVQVSRQSDGSRKITSIQEIIG 413

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I +Q++  Y+ +G +  G + G   +TGV RP+   +   YG
Sbjct: 414 MEGEIITSQEIFCYKRIGTNPDGTVEGMFRATGV-RPKVSEKIQTYG 459


>gi|218676252|ref|YP_002395071.1| putative Flp pilus assembly protein TadA [Vibrio splendidus LGP32]
 gi|218324520|emb|CAV25996.1| putative Flp pilus assembly protein TadA [Vibrio splendidus LGP32]
          Length = 421

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 297/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D + L +  +Q   +++   +N ++  K++ +S  +++DL + L
Sbjct: 8   YIQLRDEIFDAL----DASTLVEISNQELEEQLKDSVNILIDKKQLQVSSLKRVDLVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEQSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARL+DGSRVN++IPPLA+DG +++IRKFK+ K+ L++L  FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLMDGSRVNIVIPPLAIDGTSISIRKFKEQKIRLENLAEFGAMSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGETERIVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP   +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARTESMVMMATASLPISAIRRTIVSAVDLIVQVKRLHDGSRKVMYISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +YE     + GK+ G+  + G+S R   + RA  +G E+ + E+ 
Sbjct: 364 MEGDSVVMEDIFRYEATSNFKDGKMEGEFRTPGLSTRSVIYERAKFFGLEQAVKEIF 420


>gi|258620800|ref|ZP_05715835.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|258624766|ref|ZP_05719697.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|262164951|ref|ZP_06032689.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus VM223]
 gi|262173891|ref|ZP_06041568.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus MB-451]
 gi|258582928|gb|EEW07746.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|258586998|gb|EEW11712.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|261891249|gb|EEY37236.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus MB-451]
 gi|262027331|gb|EEY45998.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus VM223]
          Length = 421

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/418 (48%), Positives = 294/418 (70%), Gaps = 5/418 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y E++  IF  L    D   L +        ++   +N ++  K + +S  +++++ + L
Sbjct: 8   YIELRDEIFDAL----DAATLVETSHSELESQLKETVNLLIDKKHLQVSSIKRIEIVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+ GK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQALLENDDISDIMINGPSDIFIEIGGKVQKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 AVGRRIDESKPLCDARLADGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVEFGALSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I   ERIVT ED AELQLQQPH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGNTERIVTIEDAAELQLQQPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GE+T RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEVTARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E+M+ M   +LP Q +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARVESMVMMATASLPIQAIRRTIVSAVDLIVQVKRLHDGSRKVMFISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVLQ 474
           +EG+ ++ +D+ ++E  GE + GK+ GQ  S G+S R   + RA  +G +  L E+ Q
Sbjct: 364 LEGDSVVMEDIFRFENNGEFQDGKIQGQFRSPGLSTRSVIYERAKFFGLDTTLREIFQ 421


>gi|86144315|ref|ZP_01062647.1| Flp pilus assembly protein [Vibrio sp. MED222]
 gi|85837214|gb|EAQ55326.1| Flp pilus assembly protein [Vibrio sp. MED222]
          Length = 421

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 296/417 (70%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D   L +  +Q   +++   +N ++  K++ +S  +++DL + L
Sbjct: 8   YIQLRDEIFDAL----DAATLVEISNQELEEQLKDSVNILIDKKQLQVSSLKRVDLVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEQSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARL+DGSRVN++IPPLA+DG +++IRKFK+ K+ L++L  FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLMDGSRVNIVIPPLAIDGTSISIRKFKEQKIRLENLAEFGAMSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGETERIVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP   +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARTESMVMMATASLPISAIRRTIVSAVDLIVQVKRLHDGSRKVMYISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +YE     + GK+ G+  + G+S R   + RA  +G E+ + E+ 
Sbjct: 364 MEGDSVVMEDIFRYEATSNFKDGKMEGEFRTPGLSTRSVIYERAKFFGLEQAVKEIF 420


>gi|27366547|ref|NP_762074.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF [Vibrio
           vulnificus CMCP6]
 gi|27358113|gb|AAO07064.1| Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus CMCP6]
          Length = 421

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 300/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF    + ID + LS+  ++   ++++  +N ++  K++ +S  ++ +L + L
Sbjct: 8   YLDLRDEIF----DAIDASTLSEISNEELAEQLSESVNILIDKKQLQVSSLKRAELVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG   VFIE+ GK  ++ I F + +QL ++ +RI +
Sbjct: 64  YDELKGLGPLQKLVENDDISDIMINGPYDVFIEIGGKVEKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DESSP+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 NVGRRIDESSPLCDARLKDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVEFGAMSI 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ER+VT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGEGERVVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG G+IT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGQITARDLVINALRMRPDRIIVGECRGAEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR++  I EIVG
Sbjct: 304 HANTPRDAIARTESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKVMYISEIVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           +EGN ++ +D+ ++E  G  ++GK+ G+  S G+S R   + RA  +G E  + E+ 
Sbjct: 364 LEGNNVVMEDIFRFETTGSFDSGKIQGEFRSPGLSKRSVIYERARFFGLEDTVRELF 420


>gi|193213111|ref|YP_001999064.1| type II secretion system protein E [Chlorobaculum parvum NCIB 8327]
 gi|193086588|gb|ACF11864.1| type II secretion system protein E [Chlorobaculum parvum NCIB 8327]
          Length = 476

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/415 (49%), Positives = 287/415 (69%), Gaps = 1/415 (0%)

Query: 50  NFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDE 109
           N   R   +Y  K+ +   L+  ID+  +     +  R+E+  L+  ++  + + ++  E
Sbjct: 48  NNATRVDDFYATKTKLHQKLLSRIDLDSIEALTPEQLRNELGVLLTALIDEEAMPLNHQE 107

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           +  +  DL N+I+G GPL+PL+A   I++IMVNG   V+IE  G+   T I F D+  L+
Sbjct: 108 RARVVADLKNEIMGLGPLEPLLADPTISEIMVNGHQNVYIERRGRIELTDIRFSDDAHLM 167

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
            +  +IV++VGRR+DES P+ DARL DGSRVN IIPPLALDGP+LTIR+F    L +  L
Sbjct: 168 KIIDKIVSRVGRRIDESVPLADARLPDGSRVNAIIPPLALDGPSLTIRRFAVVPLQMPDL 227

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           +    +T   A LL  + +++CN++ISGGTGSGKTTLLN L+ YI + ERIVT EDTAEL
Sbjct: 228 LEKNTLTPAMAELLSALVKVKCNIIISGGTGSGKTTLLNILSGYIPQSERIVTIEDTAEL 287

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QLQQ HVVRLETRPPNIEG+GEITMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTG
Sbjct: 288 QLQQDHVVRLETRPPNIEGKGEITMRALVKNSLRMRPDRIVLGEVRSSEVIDMLQAMNTG 347

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGS+ TIHAN  R++  R+E ++ +GG  LPS+ +R++I SS+  I+Q  RL DG+R++
Sbjct: 348 HDGSLTTIHANTPRDAMARLENLVGLGGINLPSKALRQLIASSVQFIIQISRLSDGTRKV 407

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           T+I E++GMEG+VI TQ++  ++  G    G + G   +TGV RP+   +   YG
Sbjct: 408 TSIQELIGMEGDVITTQEIYNFKRTGTTPDGLVEGLFSATGV-RPKVAEKIHTYG 461


>gi|323493931|ref|ZP_08099048.1| putative Flp pilus assembly protein TadA [Vibrio brasiliensis LMG
           20546]
 gi|323311872|gb|EGA65019.1| putative Flp pilus assembly protein TadA [Vibrio brasiliensis LMG
           20546]
          Length = 421

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 297/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D   L +  +Q   +++   +N ++  KK+ +S  ++++L + L
Sbjct: 8   YIQLRDEIFDAL----DAATLVEISTQELEEQLKESVNILIDKKKLQVSSLKRVELVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+ GK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQKLVDNDDISDIMINGPSDIFIEIGGKVEKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARLLDGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLLDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVEFGAMSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGETERIVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GE++ R+LV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEVSARELVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP   +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARTESMVMMATASLPIAAIRRTIVSAVDLIVQVKRLHDGSRKVMYISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +YE   E + GK+ GQ  + G+S R   + RA  +G E+ + E+ 
Sbjct: 364 MEGDSVVMEDIFRYEASPEMKEGKIDGQFRTPGLSTRSVIYERARFFGLEQTVREIF 420


>gi|91788417|ref|YP_549369.1| type II secretion system protein E [Polaromonas sp. JS666]
 gi|91697642|gb|ABE44471.1| type II secretion system protein E [Polaromonas sp. JS666]
          Length = 464

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 294/416 (70%), Gaps = 3/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G   NR   Y E+K  I  TL++ +D+  + +      R+E+  L+  ++  + + ++  
Sbjct: 37  GGIDNRA--YQELKHHIHQTLLDRVDLESMQRLSQVQIREELRMLVERLLEEEVVVINET 94

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+ +L  D+ N++LG+GPL+ L+A   ++DI+VN   +V++E  GK   T + F ++  L
Sbjct: 95  ERKNLTRDIQNEMLGFGPLETLLADPTVSDILVNTYKQVYVERRGKLELTDVTFSNDAHL 154

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + +  +IV++VGRR+DESSP+ DARL DGSRVN IIPPLA+DGP ++IR+F    L L  
Sbjct: 155 MKIIDKIVSRVGRRIDESSPMVDARLPDGSRVNAIIPPLAIDGPIMSIRRFAAQPLRLAD 214

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           LV F ++TAE A +L+ +G+ + N+LISGGTGSGKTT+LN ++ +I + ERIVT ED AE
Sbjct: 215 LVEFKSLTAEMAEILRGLGKAKVNILISGGTGSGKTTMLNVISGFISEAERIVTVEDAAE 274

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQLQQPH+VRLETRPPNIEG+GE+T R LV+N LRMRP+RIILGEVRG E LD+LQAMNT
Sbjct: 275 LQLQQPHIVRLETRPPNIEGKGEVTQRALVRNALRMRPDRIILGEVRGGEALDMLQAMNT 334

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GSM TIHAN +R++  R+E M++M   TLP++ +R+ I+S++ V+VQ  RL DG R+
Sbjct: 335 GHEGSMATIHANTSRDALTRLENMVSMAVATLPTKAMRQQISSAISVVVQVARLTDGKRK 394

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I ++ EI GMEG VI  Q++  ++  G  E G ++G   +TGV RPRF  R   +G
Sbjct: 395 IVSVQEITGMEGEVITMQEIFTFKQTGLGENGAVLGYFCATGV-RPRFLERLQAFG 449


>gi|37676256|ref|NP_936652.1| TadA protein [Vibrio vulnificus YJ016]
 gi|320158386|ref|YP_004190764.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus MO6-24/O]
 gi|37200797|dbj|BAC96622.1| TadA protein [Vibrio vulnificus YJ016]
 gi|319933698|gb|ADV88561.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus MO6-24/O]
          Length = 421

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 299/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF    + ID + LS+  ++   ++++  +N ++  K++ +S  ++ +L + L
Sbjct: 8   YLDLRDEIF----DAIDASTLSEISNEELAEQLSESVNILIDKKQLQVSSLKRAELVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG   VFIE+ GK  ++ I F + +QL ++ +RI +
Sbjct: 64  YDELKGLGPLQKLVENDDISDIMINGPYDVFIEIGGKVEKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DESSP+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 NVGRRIDESSPLCDARLKDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVEFGAMSI 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I + ER+VT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGEGERVVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG G+IT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGQITARDLVINALRMRPDRIIVGECRGAEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR++  I EIVG
Sbjct: 304 HANTPRDAIARTESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKVMYISEIVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           +EGN ++ +D+ ++E  G  + GK+ G+  S G+S R   + RA  +G E  + E+ 
Sbjct: 364 LEGNNVVMEDIFRFETTGSFDGGKIQGEFRSPGLSKRSVIYERARFFGLEDTVRELF 420


>gi|261251278|ref|ZP_05943852.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
 gi|260938151|gb|EEX94139.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
          Length = 421

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 297/417 (71%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D   L +  +Q   +++   +N ++  KK+ +S  ++++L + L
Sbjct: 8   YIQLRDEIFDAL----DAATLVEISTQELEEQLKDSVNILIDKKKLQVSSLKRVELVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG + +FIE+ GK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQKLVDNDDISDIMINGPSDIFIEIGGKVEKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARLLDGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLLDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVEFGAMSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CNVLISGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQ+PH+V
Sbjct: 184 EMAKLLSIASHCKCNVLISGGTGSGKTTLLNALSGFIGETERIVTIEDAAELQLQKPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GE++ R+LV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEVSARELVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M   +LP   +R  I S++D+IVQ +RL DGSR++  I EI+G
Sbjct: 304 HANTPRDAIARTESMVMMATASLPIAAIRRTIVSAVDLIVQVKRLHDGSRKVMYISEIIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +YE   E + GK+ G+  + G+S R   + RA  +G E+ + E+ 
Sbjct: 364 MEGDSVVMEDIFRYEASPEMKDGKIDGEFRTPGLSTRSVIYERARFFGLEQTVREIF 420


>gi|56477522|ref|YP_159111.1| secretion ATPase protein, type II secretion system protein E
           [Aromatoleum aromaticum EbN1]
 gi|56313565|emb|CAI08210.1| probable secretion ATPase protein,similar to bacterial type II
           secretion system protein E [Aromatoleum aromaticum EbN1]
          Length = 450

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/407 (50%), Positives = 280/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  +K  I   L+  ID+  +        RDE+  ++  +++ + + ++ +E+ DL  D+
Sbjct: 30  YQTLKMRIHQLLLSRIDLEAMESLGPDQLRDELRLMVERLLAEENVVINTNERRDLVRDI 89

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             ++LG GP++PL+A   ++DI++NGS ++++E +GK   T + F D+  L+ +  +IV+
Sbjct: 90  QYEMLGLGPIEPLLADPTVSDILINGSQQIYVERHGKIELTPVTFSDDAHLMKIIDKIVS 149

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDESSP+ DARL DGSRVN IIPPLALDGP ++IR+F    LT++ L+ F A+T 
Sbjct: 150 RVGRRVDESSPMVDARLPDGSRVNAIIPPLALDGPVVSIRRFAAVPLTMEKLIGFKALTP 209

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E   LL  + R + N+LISGGTGSGKTTLLN LT  I  DERIVT ED AELQLQQPHVV
Sbjct: 210 EMGELLAGLARAKVNILISGGTGSGKTTLLNILTANIPADERIVTIEDAAELQLQQPHVV 269

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GE++ R LV+N LRMRP+RIILGE RG E  D+LQAMNTGH+GSM T+
Sbjct: 270 RLETRPPNIEGKGEVSQRALVRNALRMRPDRIILGETRGAEAFDVLQAMNTGHEGSMTTV 329

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++ GRME MI M    LP ++ R  I S++ +IVQ  RL DG R+I +I EI G
Sbjct: 330 HANTPRDALGRMENMIGMSDANLPPKVARSQIASAIGLIVQASRLTDGKRKIISIQEITG 389

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  +   G  ETG++ G   +TGV RP F  R   +G
Sbjct: 390 MEGEMITMQEIFAFRQTGISETGEVQGYFTATGV-RPHFAERLRSFG 435


>gi|157375503|ref|YP_001474103.1| putative pilus assembly protein [Shewanella sediminis HAW-EB3]
 gi|157317877|gb|ABV36975.1| putative pilus assembly protein [Shewanella sediminis HAW-EB3]
          Length = 441

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/405 (50%), Positives = 290/405 (71%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           ++K  ++  L+ ++D++ +     + AR +I  +  +++S   + ++L  +  L + + +
Sbjct: 21  QIKEQVYNKLLNVMDLSLIETISKEQARGQINEICEKLISELHLPINLTSRQHLIKLIID 80

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++LG GPL+ L+A   I+DI+VN  +++++E  GK  +  I F  N  LL++  RIV+ V
Sbjct: 81  EVLGLGPLETLLADPTISDILVNSFDRIYVERRGKLEQVSIKFHSNAHLLNIIDRIVSSV 140

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVN IIPPLALDGP L+IR+F  DKL  + L++ G++T E 
Sbjct: 141 GRRIDESSPMVDARLEDGSRVNAIIPPLALDGPALSIRRFSVDKLNAEQLINIGSITPEM 200

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             LL+   + + N+L+SGGTGSGKTTLLN L+ YI +DERIVT ED+AELQLQQPH VRL
Sbjct: 201 NELLKAAVKGKLNILVSGGTGSGKTTLLNMLSGYIPRDERIVTIEDSAELQLQQPHTVRL 260

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP NIEG GEIT RDLVKNCLRMRP+RI++GEVRG E LD+L AMNTGH+GS+ T+HA
Sbjct: 261 ETRPANIEGRGEITQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMNTGHEGSLTTLHA 320

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ R++ GR+E M+ M GF +P   +R  I S+++++VQ +RL DG+RR+T+I EI GME
Sbjct: 321 NSPRDALGRLEYMVCMAGFDMPVSNIRTQIASAINLVVQLERLEDGTRRVTSIQEINGME 380

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G VI   ++ ++   G D+ G +IG+  STGV  P F N+  Q+G
Sbjct: 381 GEVITMSEIFRFVREGRDQNGDIIGKFNSTGVI-PGFHNKLKQHG 424


>gi|328470521|gb|EGF41432.1| hypothetical protein VP10329_06972 [Vibrio parahaemolyticus 10329]
          Length = 421

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 294/418 (70%), Gaps = 1/418 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           H  EV   I   + + +D   L   +      ++   +N ++  K++ +S  ++LDL + 
Sbjct: 3   HLKEVYIDIRDEIFDALDAASLVDVEPLELESQLKDSVNILIEKKQLQISSLKRLDLVKA 62

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           L +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI 
Sbjct: 63  LLDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEKSPIQFVNEKQLNTIAKRIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           + VGRR+DES P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++
Sbjct: 123 SNVGRRIDESKPLCDARLEDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVQFGALS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I   ERIVT ED AELQLQQPH+
Sbjct: 183 VEMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGSGERIVTIEDAAELQLQQPHI 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMST 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR+I  I EIV
Sbjct: 303 LHANTPRDAIARVESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKILFISEIV 362

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           G+EG+ ++ +D+ ++E  G  + GK+ G+  + G+S R   + RA  +G +  L E+ 
Sbjct: 363 GLEGDSVVMEDIFRFENNGVGDEGKISGEFRTPGLSKRSVIYERAKFFGLDGTLQELF 420


>gi|153836408|ref|ZP_01989075.1| CpaF [Vibrio parahaemolyticus AQ3810]
 gi|149750310|gb|EDM61055.1| CpaF [Vibrio parahaemolyticus AQ3810]
          Length = 421

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 294/418 (70%), Gaps = 1/418 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           H  EV   I   + + +D   L   +      ++   +N ++  K++ +S  ++LDL + 
Sbjct: 3   HLKEVYIDIRDEIFDALDAASLVDVEPLELESQLKDSVNILIEKKQLQISSLKRLDLVKA 62

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           L +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI 
Sbjct: 63  LLDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEKSPIQFVNEKQLNTIAKRIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           + VGRR+DES P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++
Sbjct: 123 SNVGRRIDESKPLCDARLEDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVQFGALS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I   ERIVT ED AELQLQQPH+
Sbjct: 183 VEMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGSGERIVTIEDAAELQLQQPHI 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMST 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR+I  I EIV
Sbjct: 303 LHANTPRDAIARVESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKILFISEIV 362

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           G+EG+ ++ +D+ ++E  G  + GK+ G+  + G+S R   + RA  +G +  L E+ 
Sbjct: 363 GLEGDSVVMEDIFRFENNGVGDEGKISGEFRTPGLSKRSVIYERAKFFGLDGALQELF 420


>gi|28900579|ref|NP_800234.1| hypothetical protein VPA0724 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365459|ref|ZP_05777996.1| type II/IV secretion system protein [Vibrio parahaemolyticus K5030]
 gi|260877524|ref|ZP_05889879.1| type II/IV secretion system protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260897535|ref|ZP_05906031.1| protein TadA [Vibrio parahaemolyticus Peru-466]
 gi|260901737|ref|ZP_05910132.1| type II/IV secretion system protein [Vibrio parahaemolyticus
           AQ4037]
 gi|28808959|dbj|BAC62067.1| TadA [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087119|gb|EFO36814.1| protein TadA [Vibrio parahaemolyticus Peru-466]
 gi|308090838|gb|EFO40533.1| type II/IV secretion system protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308108845|gb|EFO46385.1| type II/IV secretion system protein [Vibrio parahaemolyticus
           AQ4037]
 gi|308114383|gb|EFO51923.1| type II/IV secretion system protein [Vibrio parahaemolyticus K5030]
          Length = 421

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 294/418 (70%), Gaps = 1/418 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           H  EV   I   + + +D   L   +      ++   +N ++  K++ +S  ++LDL + 
Sbjct: 3   HLKEVYIDIRDEIFDALDAASLVDVEPLELESQLKDSVNILIEKKQLQISSLKRLDLVKA 62

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           L +++ G GPLQ L+  DDI+DIM+NG + +FIE+NGK  ++ I F + +QL ++ +RI 
Sbjct: 63  LLDELKGLGPLQALVDNDDISDIMINGPSDIFIEINGKVEKSPIQFVNEKQLNTIAKRIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           + VGRR+DES P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++
Sbjct: 123 SNVGRRIDESKPLCDARLEDGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVQFGALS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I   ERIVT ED AELQLQQPH+
Sbjct: 183 VEMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGSGERIVTIEDAAELQLQQPHI 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMST 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR+I  I EIV
Sbjct: 303 LHANTPRDAIARVESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKILFISEIV 362

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           G+EG+ ++ +D+ ++E  G  + GK+ G+  + G+S R   + RA  +G +  L E+ 
Sbjct: 363 GLEGDSVVMEDIFRFENNGIGDEGKISGEFRTPGLSKRSVIYERAKFFGLDGALQELF 420


>gi|78186533|ref|YP_374576.1| type II secretion system protein [Chlorobium luteolum DSM 273]
 gi|78166435|gb|ABB23533.1| type II secretion system protein [Chlorobium luteolum DSM 273]
          Length = 479

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/407 (51%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +Y  K  +   L+  ID+  +     +  R ++ TL+ E++  + I ++  E+  L  DL
Sbjct: 60  FYATKRKLHQKLLTRIDLNSIESLSPEQLRTQLGTLLLELIEEEAIPLNDQERTRLIADL 119

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N+I+G GPL+PL+A   I++IMVNG + V+IE  GK   T + F D+  L+ +  +IV+
Sbjct: 120 KNEIMGLGPLEPLLADPAISEIMVNGYHNVYIEKKGKIELTDVRFNDDAHLMKIIDKIVS 179

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPPLALDGP LTIR+F    L +D +V    +T 
Sbjct: 180 RVGRRIDESSPMVDARLPDGSRVNAIIPPLALDGPILTIRRFSVVPLQMDDIVQKETLTP 239

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + +++CN++ISGGTGSGKTTLLN L+ YI  DERIVT EDTAELQ Q  HV+
Sbjct: 240 AVAELLAALVKVKCNIIISGGTGSGKTTLLNILSGYIPADERIVTIEDTAELQFQHDHVI 299

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LETRPPNIEG+GEITMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTGHDGS+ TI
Sbjct: 300 HLETRPPNIEGKGEITMRALVKNTLRMRPDRIVLGEVRSSEVIDMLQAMNTGHDGSLTTI 359

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN++R++ GR+E ++ M G +LP++ +R++I SS+  I+Q  R  DGSR+IT+I EI G
Sbjct: 360 HANSSRDALGRLENLVGMAGISLPTKALRQLIISSIHFIIQISRQSDGSRKITSIQEITG 419

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I TQ++  Y   G    G + G   +TGV RP+ + +   YG
Sbjct: 420 MEGEMITTQEIFSYTRTGTKPDGTVEGLFRATGV-RPKVYEKILTYG 465


>gi|114799052|ref|YP_759872.1| type II/IV secretion system protein [Hyphomonas neptunium ATCC
           15444]
 gi|114739226|gb|ABI77351.1| type II/IV secretion system protein [Hyphomonas neptunium ATCC
           15444]
          Length = 462

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 285/407 (70%), Gaps = 5/407 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           + K  +   LI+ +D++ L + D ++ R  +  +++EI+  +++ +S  E+    + + +
Sbjct: 45  DAKLRVHAKLIDELDLSALDKLDDETMRRRVRGIISEIIRKEEMALSAAEEASFADAVMD 104

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GP++PL+  D IADI++NG N+V+IE  GK     + F DN+ LL + QRIV  V
Sbjct: 105 EMTGLGPIEPLLKDDSIADILINGCNQVYIERGGKLQLAPVRFADNDHLLRIVQRIVAAV 164

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES P+ DARLLDGSRVN  + P+A+DGP ++IRKF K  LT+D LV+FGA+    
Sbjct: 165 GRRVDESQPLVDARLLDGSRVNAAVAPIAIDGPLVSIRKFSKSPLTMDKLVAFGAIPKPV 224

Query: 240 ARLLQIIGRIRC--NVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           A    I+G ++C  + +ISGGTGSGKTTLLN L+  I+ DER++T ED AELQLQQPHV 
Sbjct: 225 AEF--ILGAVKCRASTVISGGTGSGKTTLLNALSAAINPDERLITIEDAAELQLQQPHVA 282

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETRPPNIEG+GEI  R+LVKN LRMRP+R+ILGEVR  E  D+LQAMNTGH+GSM TI
Sbjct: 283 RMETRPPNIEGKGEIRQRELVKNALRMRPDRVILGEVRSEEAFDMLQAMNTGHEGSMATI 342

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HANN R++  R+E M+ MGG  +  + +R  I S+++ IVQ  RL DGSR++ +I EI G
Sbjct: 343 HANNPRDAITRLEQMVMMGGMKISEEAIRGQIASAVNFIVQATRLSDGSRKVISIAEITG 402

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG+V+  Q++ K+E  G    GK+ G  ++TG+ RP+F +   + G
Sbjct: 403 MEGSVVQLQEIFKFERTGTTPEGKVQGHFVATGL-RPKFVDEMERKG 448


>gi|194335917|ref|YP_002017711.1| type II secretion system protein E [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308394|gb|ACF43094.1| type II secretion system protein E [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 473

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/406 (51%), Positives = 291/406 (71%), Gaps = 1/406 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           Y  K+ +   L+  ID++ +     +  R+E+  L+ E++  ++I  +  E+  L  DL 
Sbjct: 55  YATKTKLHQKLLTRIDLSSIESLTPEQLRNELGVLLVELIEEEEIRFNDQERAKLVADLK 114

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           N+I+G GPL+PL+A   I++IMVNG   V+IE NG    T I+F D+  L+ +  +IV++
Sbjct: 115 NEIMGLGPLEPLLADPAISEIMVNGCQNVYIEKNGCIQPTNIHFNDDAHLMKIIDKIVSR 174

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DES P+ DARL DG+RVN IIPPLALDGP LTIR+F    L +   +    +T+ 
Sbjct: 175 VGRRIDESCPMVDARLPDGARVNAIIPPLALDGPVLTIRRFAVVPLQMSDFIEKNTLTSA 234

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A LL  + + +CN++ISGGTGSGKTTLLN L+ +I ++ERIVT EDTAELQLQQ HV+R
Sbjct: 235 MAELLSALVKAKCNIIISGGTGSGKTTLLNILSSFIPENERIVTIEDTAELQLQQNHVIR 294

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETR PNIEG+GEITMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTGH+GS+ TIH
Sbjct: 295 LETRTPNIEGKGEITMRVLVKNSLRMRPDRIVLGEVRSSEVIDMLQAMNTGHEGSLTTIH 354

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+ R + GR+E ++ M G TLP++ +RE+I+SSLD I+Q  RL DGSR+IT+I EI+GM
Sbjct: 355 ANSPRHALGRLENLVGMDGITLPTKALRELISSSLDFIIQITRLNDGSRKITSIEEIIGM 414

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EG++I TQ++  Y+ MG +  G + G   +TGV RP+ + +   YG
Sbjct: 415 EGDIITTQEIFCYKRMGINPDGSVQGMFRATGV-RPKVYEKIHTYG 459


>gi|167842454|ref|ZP_02469138.1| type II secretion system protein [Burkholderia thailandensis
           MSMB43]
          Length = 455

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/407 (49%), Positives = 293/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EI+TL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEISTLIARILDEEKLLANDLERRQLTVDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPTVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV++  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNYQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ YI  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGYIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN AR++  R+E MI + G +LP + +R+ I+S+L V+VQT RL DG RRI +I E+ G
Sbjct: 333 HANTARDALTRLENMIGVSGLSLPPKTMRQQISSALSVVVQTTRLTDGKRRIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D  G ++G   +TGV RP+F  R + +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDANGNVLGYFTATGV-RPKFAERLSAFG 438


>gi|323700363|ref|ZP_08112275.1| type II secretion system protein E [Desulfovibrio sp. ND132]
 gi|323460295|gb|EGB16160.1| type II secretion system protein E [Desulfovibrio desulfuricans
           ND132]
          Length = 472

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/410 (49%), Positives = 287/410 (70%), Gaps = 3/410 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLF 114
           HY+++K+ I   LI+MID++ L        R EI+ +   ++    +   ++L E+  + 
Sbjct: 45  HYFDIKTRIHDRLIDMIDLSLLDSLSETEMRSEISKVTEGLLWGEFRNAPLNLAERKRML 104

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ ++++G GPL+P +    + DI+VNG  ++++E +GK   T   F+D++ L  +  R
Sbjct: 105 SEIQDEVIGLGPLEPYVQDPTVNDILVNGYKQIYVERSGKLELTPARFKDDDHLRKIIDR 164

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+ VGRR+DES P+CDARLLDGSRVN +IPPLA+DGP+L+IRKF KD L +  L+ F +
Sbjct: 165 IVSLVGRRIDESQPLCDARLLDGSRVNAVIPPLAIDGPSLSIRKFSKDPLEVADLIGFNS 224

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T E A L++ I + + NVLISGGTGSGKTTLLNCL+R + +DERIVT ED AELQL+Q 
Sbjct: 225 LTPEMALLMKGIVQSQLNVLISGGTGSGKTTLLNCLSRNVPEDERIVTIEDAAELQLKQD 284

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRP NIEG GEITMRDLVKNCLRMRP+RII+GEVR  E LD+LQAMNTGHDGS+
Sbjct: 285 HVVRLETRPANIEGRGEITMRDLVKNCLRMRPDRIIVGEVRSAEALDMLQAMNTGHDGSL 344

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
             IHAN  R++  R+E MI+M G  L    ++  I+S++DVI+Q  RL DG+R++ +I E
Sbjct: 345 TIIHANTPRDALMRLETMISMAGLNLNPLSMKRYISSAIDVIIQATRLVDGTRKVISIQE 404

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + GMEG +I  Q++  +E  G    GK+ G   + G+ RP+F  +  + G
Sbjct: 405 VTGMEGEMITMQEIFAFEQTGLTHDGKVEGYFTARGI-RPKFAEKLERMG 453


>gi|309792341|ref|ZP_07686811.1| type II secretion system protein E [Oscillochloris trichoides DG6]
 gi|308225656|gb|EFO79414.1| type II secretion system protein E [Oscillochloris trichoides DG6]
          Length = 415

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 277/378 (73%), Gaps = 1/378 (0%)

Query: 82  DSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMV 141
           D    R ++    N I+  + I MS  E+  LFE +  DI+G GPL+ L++ +DI++IMV
Sbjct: 17  DKAKVRKQVEEAFNAILDGESIVMSRAERSKLFESIEADIIGLGPLEQLLSDEDISEIMV 76

Query: 142 NGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVN 201
           NG  +++IE  GK + T I F +++ +L +  RIV  +GRR+DESSP+ DARL DGSRVN
Sbjct: 77  NGPKRIYIERKGKLIRTDITFLNDDHVLRIIDRIVAPLGRRIDESSPMVDARLQDGSRVN 136

Query: 202 VIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGS 261
            +I PLAL+GPTLTIRKF+K+ L+++ L+ FG++  E A  L+   + R N++++GGTGS
Sbjct: 137 AVIRPLALNGPTLTIRKFRKNPLSINDLIRFGSMNREMADFLEACVKARLNIVVAGGTGS 196

Query: 262 GKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNC 321
           GKTTLLN L+ +I +DERI+T E+ AELQL Q HVV LE+RPPN+EG GE+++RDLV NC
Sbjct: 197 GKTTLLNVLSSFIPEDERIITVENAAELQLLQDHVVTLESRPPNVEGRGEVSIRDLVINC 256

Query: 322 LRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLP 381
           LRMRPERI++GE RG E LD+LQAMNTGHDGSM TIHAN+ R+  GR+E M  M G  LP
Sbjct: 257 LRMRPERIVVGECRGGETLDMLQAMNTGHDGSMTTIHANSPRDGIGRIETMCLMAGMDLP 316

Query: 382 SQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGK 441
           ++ +RE I S++ + VQ  RL+DGSRR+T I E+ GMEG+V++ QD+  +E  G DE GK
Sbjct: 317 ARAIREQIVSAVQIFVQQSRLQDGSRRVTQITEVSGMEGDVVVLQDIFVFEQTGLDERGK 376

Query: 442 LIGQHISTGVSRPRFWNR 459
           ++GQ  +TGV RP+F  +
Sbjct: 377 IVGQLRATGV-RPKFIEK 393


>gi|76818351|ref|YP_336473.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|167744181|ref|ZP_02416955.1| type II secretion system protein [Burkholderia pseudomallei 14]
 gi|167821380|ref|ZP_02453060.1| type II secretion system protein [Burkholderia pseudomallei 91]
 gi|167899819|ref|ZP_02487220.1| type II secretion system protein [Burkholderia pseudomallei 7894]
 gi|167916483|ref|ZP_02503574.1| type II secretion system protein [Burkholderia pseudomallei 112]
 gi|167924340|ref|ZP_02511431.1| type II secretion system protein [Burkholderia pseudomallei BCC215]
 gi|254187129|ref|ZP_04893644.1| type II/IV secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254262932|ref|ZP_04953797.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1710a]
 gi|76582824|gb|ABA52298.1| type II secretion system protein [Burkholderia pseudomallei 1710b]
 gi|157934812|gb|EDO90482.1| type II/IV secretion system protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254213934|gb|EET03319.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1710a]
          Length = 455

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|328953760|ref|YP_004371094.1| type II secretion system protein E [Desulfobacca acetoxidans DSM
           11109]
 gi|328454084|gb|AEB09913.1| type II secretion system protein E [Desulfobacca acetoxidans DSM
           11109]
          Length = 449

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 301/440 (68%), Gaps = 12/440 (2%)

Query: 30  SNIQKQNLQSSSPSAEGEIGNFV-----NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQ 84
           + +QKQ      P+ +  +GN        +   Y E+KS +   L++++D+++L+  D  
Sbjct: 5   ARLQKQ------PTRKASVGNGFRTEEQKKEDFYNELKSRVHYRLLDLLDLSRLAGADDA 58

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
               +I   +  I+    I +SL E+  L +D+ +++LGYGPL+ L+    ++D++VNG 
Sbjct: 59  QLFQDIRRGIEIILGEDNIALSLTEKERLTKDIRDELLGYGPLEQLLGDATVSDVLVNGY 118

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
           + V++E  GK  +T + F+DN  LL + ++I + VGRRVDES P+ DARL DGSRVN II
Sbjct: 119 DSVYVERRGKLEKTPVRFKDNAHLLKIIEKIASGVGRRVDESCPMVDARLPDGSRVNAII 178

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
            PLALDGP L+IRKF KD   +  L+ FG +T   A++L+ + + R N+LISGGTGSGKT
Sbjct: 179 APLALDGPALSIRKFSKDPYKVHDLIEFGTITEGIAKVLEAMVKARLNILISGGTGSGKT 238

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +I  DERI+T ED AELQLQQ HVVRLETRPPN+EG GE+T RDLV+N LRM
Sbjct: 239 TFLNVLSAFIPNDERIITIEDAAELQLQQDHVVRLETRPPNMEGMGEVTQRDLVRNALRM 298

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RPERIILGEVR  E LD+LQAMNTGHDGS+ TIHAN  R++  R+E M+AM G  +P + 
Sbjct: 299 RPERIILGEVRQAEALDMLQAMNTGHDGSLATIHANTPRDALVRLETMVAMAGLNIPDKA 358

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           +R  I S++ V++Q  RL+DGSR++  + EIVGMEG VI+ Q++ +YE++G  E GK+ G
Sbjct: 359 LRHQIASAIHVVIQVARLKDGSRKMLYLNEIVGMEGEVIVMQEIFRYEMLGLTEEGKVRG 418

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TG+ RP+F  +    G
Sbjct: 419 RFRATGI-RPKFMTQLEALG 437


>gi|299067810|emb|CBJ39021.1| Tad secretion sytem protein, secretion ATPase [Ralstonia
           solanacearum CMR15]
          Length = 456

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/410 (49%), Positives = 289/410 (70%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P Y ++   I  T+I+ +++++L Q      R E+A L+  IV      ++  E+  L 
Sbjct: 32  SPAYQQLAIEIHQTIIDRVELSRLQQLTPDQVRRELALLVERIVEEGNHPVNEAERHRLV 91

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            D+ +++LGYGPL+PL+A   I+DI+VN   +V++E  GK   T + F ++  L+ V ++
Sbjct: 92  ADVQDEMLGYGPLEPLLADPTISDILVNTCKQVYVERRGKLELTDVTFHNDAHLMRVIEK 151

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           +V+++GRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+  L+ +  
Sbjct: 152 MVSRMGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTVKDLIEYNT 211

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T + A+LL+ + + + N+LISGGTGSGKTTLLN L+ YI  +ER+VT ED AELQL+QP
Sbjct: 212 LTPQMAQLLEAMVQAKLNILISGGTGSGKTTLLNILSGYIPVNERVVTIEDAAELQLRQP 271

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HV+RLETRPPNIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNTGH+GS+
Sbjct: 272 HVLRLETRPPNIEGRGEITQRSLVKNALRMRPDRIILGEVRGAEALDMLHAMNTGHEGSL 331

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN  R++  R+E M++M G  LP++ +R+ ITS+L V+VQ  RL DG R++ ++ E
Sbjct: 332 ATIHANTPRDALTRLENMVSMSGLQLPTKTMRQQITSALSVVVQVTRLTDGRRKLVSVQE 391

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG+++  Q++  +   G D  G++ G   +TGV RP+F  R   YG
Sbjct: 392 ITGMEGDIVNMQEIFTFRRRGVDREGRIQGHFCATGV-RPKFSERLQSYG 440


>gi|78357406|ref|YP_388855.1| type II/IV secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219811|gb|ABB39160.1| type II/IV secretion system protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 560

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/409 (51%), Positives = 292/409 (71%), Gaps = 3/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS--VKKITMSLDEQLDLFE 115
           YYE K+ +   ++E++DI+     + +    EI  L+ +++    ++I ++  E+  + E
Sbjct: 138 YYEAKARVHARVLELMDISAAEHLNPEVLGTEIRRLVEKVLHEEYRQIPLNSQERRRVAE 197

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           ++ ++ILG GPL+PL+A   ++DI+VN   +V++E  GK  + G+ F D+E L  +  RI
Sbjct: 198 EIQHEILGLGPLEPLLADPSVSDILVNNYRQVYVERGGKLHKAGVRFHDDEHLRQIIDRI 257

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+++GRRVDESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F KD L L+ L+ F A+
Sbjct: 258 VSRIGRRVDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFSKDPLELEDLIRFKAL 317

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T E   +L+ I + R N+++SGGTGSGKTT+LNCL+R++  DERIVT ED AELQL+Q H
Sbjct: 318 TPEMGEVLRGIVKARLNIIVSGGTGSGKTTMLNCLSRFVPHDERIVTIEDAAELQLKQEH 377

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRP NIEG GEIT RDLVKNCLRMRP+RII+GEVR  EVLD+LQAMNTGHDGS+ 
Sbjct: 378 VVRLETRPANIEGHGEITARDLVKNCLRMRPDRIIVGEVRSAEVLDMLQAMNTGHDGSLT 437

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHAN+ R+   R+E M+AM G  + +  ++  ITS++DVIVQ  RL DGSR++T++ EI
Sbjct: 438 TIHANSPRDCLMRLETMVAMSGLNISTLSLKRYITSAVDVIVQVSRLSDGSRKLTSLTEI 497

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            GMEG  +  Q++  +   G  + GK+ G     G+ RPRF +R A  G
Sbjct: 498 TGMEGEAVTMQEIFSFRQTGVGQDGKVTGSFAGAGI-RPRFASRLAAAG 545


>gi|53723213|ref|YP_112198.1| type II/IV secretion system-related protein [Burkholderia
           pseudomallei K96243]
 gi|254296489|ref|ZP_04963945.1| type II/IV secretion system protein [Burkholderia pseudomallei
           406e]
 gi|52213627|emb|CAH39681.1| putative type II/IV secretion system-related protein [Burkholderia
           pseudomallei K96243]
 gi|157806545|gb|EDO83715.1| type II/IV secretion system protein [Burkholderia pseudomallei
           406e]
          Length = 455

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|84385701|ref|ZP_00988732.1| TadA [Vibrio splendidus 12B01]
 gi|84379681|gb|EAP96533.1| TadA [Vibrio splendidus 12B01]
          Length = 421

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/417 (48%), Positives = 293/417 (70%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y E++  IF  L    D   L   DS     ++   +N ++  K++ +S  +++DL + L
Sbjct: 8   YIEIRDEIFDAL----DAASLVDVDSGELEGQLKESVNILIERKQLQISNLKRMDLVKAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  D+I+DIM+NG   +FIE+NGK  ++ I F + +QL ++ +RI +
Sbjct: 64  LDELKGLGPLQALVDNDNISDIMINGPADIFIEINGKVEKSPIQFVNEKQLNTIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 NVGRRIDESKPLCDARLEDGSRVNIVIPPLAIDGTSISIRKFKEHKIKLENLVEFGALSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I    +CN+LISGGTGSGKTTLLN L+ +I   ER++T ED AELQLQQ H+V
Sbjct: 184 EMAKLLSIASHCKCNILISGGTGSGKTTLLNALSGFIGGGERVITIEDAAELQLQQEHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GEIT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEITARDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E+M+ M   +LP + +R  I S++D+IVQ +RL DGSR+I  I EIVG
Sbjct: 304 HANTPRDAIARVESMVMMATASLPLEAIRRTIVSAVDLIVQVRRLHDGSRKILFISEIVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS-RPRFWNRAAQYGEEKNLAEVL 473
           +EG+ ++ +D+ +YE  G    GK+ G++ + G+S R   + RA  +G +  L E+ 
Sbjct: 364 LEGDNVVMEDIFRYENTGGMIDGKIAGEYRTPGLSKRSVIYERAKFFGLDGALQELF 420


>gi|217424383|ref|ZP_03455882.1| type II/IV secretion system protein [Burkholderia pseudomallei 576]
 gi|237510619|ref|ZP_04523334.1| tight adherence protein TadA [Burkholderia pseudomallei MSHR346]
 gi|217392848|gb|EEC32871.1| type II/IV secretion system protein [Burkholderia pseudomallei 576]
 gi|235002824|gb|EEP52248.1| tight adherence protein TadA [Burkholderia pseudomallei MSHR346]
          Length = 455

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIISIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|126457824|ref|YP_001076995.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|167829722|ref|ZP_02461193.1| type II/IV secretion system protein [Burkholderia pseudomallei 9]
 gi|167851189|ref|ZP_02476697.1| type II/IV secretion system protein [Burkholderia pseudomallei
           B7210]
 gi|226194133|ref|ZP_03789733.1| type II/IV secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242313841|ref|ZP_04812858.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1106b]
 gi|254182577|ref|ZP_04889171.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1655]
 gi|254192563|ref|ZP_04899002.1| type II/IV secretion system protein [Burkholderia pseudomallei S13]
 gi|126231592|gb|ABN95005.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1106a]
 gi|169649321|gb|EDS82014.1| type II/IV secretion system protein [Burkholderia pseudomallei S13]
 gi|184213112|gb|EDU10155.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1655]
 gi|225933826|gb|EEH29813.1| type II/IV secretion system protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|242137080|gb|EES23483.1| type II/IV secretion system protein [Burkholderia pseudomallei
           1106b]
          Length = 455

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIISIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|300704933|ref|YP_003746536.1| tad secretion sytem protein, secretion ATPase [Ralstonia
           solanacearum CFBP2957]
 gi|299072597|emb|CBJ43947.1| Tad secretion sytem protein, secretion ATPase [Ralstonia
           solanacearum CFBP2957]
          Length = 454

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/416 (49%), Positives = 286/416 (68%), Gaps = 1/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G   + +  Y +V   I  T+I+ +++ +L Q +    + E+A L+  +V   K  ++  
Sbjct: 24  GTAASTSAAYQQVAMDIHQTIIDRVELGRLQQLEPDQVKRELAQLVERLVDEGKHQLNEA 83

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+ +++LGYGPL+PL+A   I+DI+VN   +V++E  GK   T + F D+  L
Sbjct: 84  ERRRLVSDVQDEMLGYGPLEPLLADPTISDILVNTYRRVYVERRGKLELTTVTFHDDAHL 143

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + V +++V++VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+  
Sbjct: 144 MRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIQD 203

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+ F  +T E A+LL  + + + N+LISGGTGSGKTTLLN L+ YI  DERIVT ED AE
Sbjct: 204 LIGFRTLTPEMAQLLDAMVKAKLNILISGGTGSGKTTLLNILSGYIPADERIVTIEDAAE 263

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HV+RLETRP NIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNT
Sbjct: 264 LQLRQNHVLRLETRPANIEGRGEITQRSLVKNALRMRPDRIILGEVRGAEALDMLHAMNT 323

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ TIHAN  R++  R+E MI+M G +LP +  R+ ITS+L V+VQ  RL DG R+
Sbjct: 324 GHEGSLATIHANTPRDALTRLENMISMAGLSLPPKTTRQQITSALTVVVQVSRLTDGYRK 383

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + ++ EI GMEG V+  Q++  +   G D  G++ G   +TGV RP+F  R   +G
Sbjct: 384 LVSVQEITGMEGEVVNMQEIFAFRRKGIDRDGRIKGHFCATGV-RPKFSERLQAFG 438


>gi|167725254|ref|ZP_02408490.1| type II secretion system protein [Burkholderia pseudomallei DM98]
          Length = 455

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIISIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|167908136|ref|ZP_02495341.1| type II secretion system protein [Burkholderia pseudomallei NCTC
           13177]
          Length = 455

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIFSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|134281824|ref|ZP_01768531.1| type II/IV secretion system protein [Burkholderia pseudomallei 305]
 gi|134246886|gb|EBA46973.1| type II/IV secretion system protein [Burkholderia pseudomallei 305]
          Length = 455

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIFSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLTAFG 438


>gi|258405285|ref|YP_003198027.1| type II secretion system protein E [Desulfohalobium retbaense DSM
           5692]
 gi|257797512|gb|ACV68449.1| type II secretion system protein E [Desulfohalobium retbaense DSM
           5692]
          Length = 469

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 290/411 (70%), Gaps = 3/411 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSV--KKITMSLDEQLDLFE 115
           Y+ +K+ I T L++M+D++ +   + +  + +I +L+ +I+    +   +++ E+  LF 
Sbjct: 46  YFLLKNRIHTRLLDMVDLSMIDSLEPEVLKTQIRSLVTKILDTEERNAPLNMSERERLFS 105

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+ ++++G GPL+P +  D +ADI+VN  N++++E  GK   +   F+D+  L+ +  +I
Sbjct: 106 DIEDEVMGLGPLEPFLKDDTVADILVNTHNQIYVERFGKLELSESTFKDDAHLMRIIDKI 165

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+ VGRR+DESSP+ DARL DGSRVNVIIPPLALDGP ++IR+F KD L +D L+   A 
Sbjct: 166 VSSVGRRIDESSPMVDARLADGSRVNVIIPPLALDGPVMSIRRFGKDPLKMDDLIMLRAF 225

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T     +++ I R   NV+ISGGTGSGKTTLLNCL+++I   +RI+T ED AELQL+Q H
Sbjct: 226 TQGIGEIMKGIVRSELNVVISGGTGSGKTTLLNCLSQFIPATDRIITIEDAAELQLKQEH 285

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRPPNIEG+GE+T R+LV+N LRMRP+RII+GEVRG E  D+LQAMNTGHDGS+ 
Sbjct: 286 VVRLETRPPNIEGKGEVTARELVRNSLRMRPDRIIVGEVRGSESFDMLQAMNTGHDGSLT 345

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHAN  R++  R+E+M++M    +P + +R  I S++ +I+Q  R  DG+R++ +I EI
Sbjct: 346 TIHANTPRDALMRIESMVSMANLDIPIEFMRRFIASAIHIIIQVSRYSDGTRKVNSIQEI 405

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
            GMEGNVI TQ++  +   G DE GK+ G     GV RP+F ++  Q G E
Sbjct: 406 TGMEGNVITTQEIFSFNPTGVDENGKVKGYFRFNGV-RPQFVDKFHQVGIE 455


>gi|21673273|ref|NP_661338.1| type II secretion system protein [Chlorobium tepidum TLS]
 gi|21646362|gb|AAM71680.1| type II secretion system protein [Chlorobium tepidum TLS]
          Length = 480

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 214/419 (51%), Positives = 293/419 (69%), Gaps = 3/419 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           N  P YY  K+ +   L+  ID+  +   D+   R+E+  L+  ++  + + ++  E+  
Sbjct: 56  NGDPDYYSAKTKLHQKLLTRIDLNSIESLDADQLRNELGMLLTRLIEEEALPLNHQERSK 115

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L  DL N+ILG GPL+PL+A  DI++IMVNG   V++E  G    T I F D+  L+ + 
Sbjct: 116 LVTDLKNEILGLGPLEPLLADPDISEIMVNGYQNVYVEKKGCISLTDIRFSDDAHLMKII 175

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            +IV+ VGRR+DESSP+ DARL DGSRVN IIPPLALDGP LTIR+F    L +  L+  
Sbjct: 176 DKIVSHVGRRIDESSPMVDARLPDGSRVNAIIPPLALDGPALTIRRFAVVPLQMHDLIEK 235

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
             +T   A LL  + +++CN++ISGGTGSGKTTLLN L+ YI  +ERI+T EDTAELQLQ
Sbjct: 236 KTLTPTMAELLSALVKVKCNIIISGGTGSGKTTLLNILSGYIPYNERIITIEDTAELQLQ 295

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HV+RLETRPPNIE +GE+TMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTGHDG
Sbjct: 296 QDHVIRLETRPPNIENKGEVTMRALVKNSLRMRPDRIVLGEVRSSEVIDMLQAMNTGHDG 355

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ TIHAN+ R++  R+E ++ +GG  LPS+ +R++I SS+  I+Q  RL DG+R+IT+I
Sbjct: 356 SLTTIHANSPRDAIARLENLVGLGGINLPSKALRQLIASSVQFIIQVSRLSDGTRKITHI 415

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
            EI+GMEG+VI TQD+  ++  G +  G + G   +TGV RPR + +   +G   NL+E
Sbjct: 416 QEIIGMEGDVITTQDIFFFQRTGTNSDGSVQGVFKATGV-RPRVYEKIRTFG--LNLSE 471


>gi|83749635|ref|ZP_00946618.1| SECRETION ATPASE; cpaF1 [Ralstonia solanacearum UW551]
 gi|207744161|ref|YP_002260553.1| secretion atpase protein [Ralstonia solanacearum IPO1609]
 gi|83723696|gb|EAP70891.1| SECRETION ATPASE; cpaF1 [Ralstonia solanacearum UW551]
 gi|206595565|emb|CAQ62492.1| secretion atpase protein [Ralstonia solanacearum IPO1609]
          Length = 454

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 286/416 (68%), Gaps = 1/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G   + +  Y +V   +   +I+ +++++L Q      + E+A L+  IV   K  ++  
Sbjct: 24  GAAASTSAAYQQVAVDVHQIIIDRVELSRLQQLTPDQVKRELAQLVERIVDEGKHQLNEA 83

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+ +++LGYGPL+PL+A   I+DI+VN   +V++E  GK   T + F D+  L
Sbjct: 84  ERRRLVSDVQDEMLGYGPLEPLLADPTISDILVNTYQRVYVERRGKLELTTVTFHDDAHL 143

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + V +++V++VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT++ 
Sbjct: 144 MRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIED 203

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+ F  +T E A+LL  + + + N+LISGGTGSGKTTLLN L+ YI  DERIVT ED AE
Sbjct: 204 LIGFRTLTPEMAQLLDAMVKAKLNILISGGTGSGKTTLLNILSGYIPADERIVTIEDAAE 263

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HV+RLETRP NIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNT
Sbjct: 264 LQLRQNHVLRLETRPANIEGRGEITQRSLVKNALRMRPDRIILGEVRGAEALDMLHAMNT 323

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ TIHAN  R++  R+E MI+M G +LP +  R+ ITS+L V+VQ  RL DG R+
Sbjct: 324 GHEGSLATIHANTPRDALTRLENMISMAGLSLPPKTTRQQITSALTVVVQVSRLTDGYRK 383

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + ++ EI GMEG V+  Q++  +   G D  G++ G   +TGV RP+F  R   +G
Sbjct: 384 LVSVQEITGMEGEVVNMQEIFAFRRKGIDRDGRIKGHFCATGV-RPKFSERLQAFG 438


>gi|126443321|ref|YP_001064082.1| type II/IV secretion system protein [Burkholderia pseudomallei 668]
 gi|126222812|gb|ABN86317.1| type II/IV secretion system protein [Burkholderia pseudomallei 668]
          Length = 455

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIATL+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIATLIARILDEEKLLANDLERRQLTIDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV+F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G  LP + +R+ I+S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLALPPKTMRQQISSALSVVVQTARLTDGKRKIISIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D +G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDASGNVLGYFTATGV-RPKFTERLNAFG 438


>gi|294140780|ref|YP_003556758.1| Flp pilus assembly protein TadA [Shewanella violacea DSS12]
 gi|293327249|dbj|BAJ01980.1| Flp pilus assembly protein TadA [Shewanella violacea DSS12]
          Length = 450

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/414 (49%), Positives = 290/414 (70%), Gaps = 1/414 (0%)

Query: 51  FVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           F   T     +K  ++  L+ ++D++ +     + A+ +I  + +++++   + ++L  +
Sbjct: 21  FKQLTSEELSLKEQLYNKLLSVMDLSLIETISKEQAQQQINEICDKLITDLHLPINLSAR 80

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             L + + +++LG GPL+ L+A   I+DI+VN  N+V+IE  GK     I F +N  LL+
Sbjct: 81  QRLIKLIIDEVLGLGPLEILLADPSISDILVNSYNRVYIERRGKLERVPIEFHNNAHLLN 140

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           +  RIV+ VGRR+DESSP+ DARL DGSRVN IIPPLALDGP L+IR+F  DK+  + L+
Sbjct: 141 IIDRIVSSVGRRIDESSPMVDARLADGSRVNAIIPPLALDGPALSIRRFAVDKMCAEDLI 200

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G++T++   LL      + N+L+SGGTGSGKTTLLN L+ YI  DERIVT ED+AELQ
Sbjct: 201 KIGSMTSQMNELLSAAVAGKLNILVSGGTGSGKTTLLNLLSGYIPVDERIVTIEDSAELQ 260

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L+QPH VRLETRP NIEG+GEI+ RDLVKNCLRMRP+RI++GEVRG E LD+L AMNTGH
Sbjct: 261 LRQPHTVRLETRPANIEGKGEISQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMNTGH 320

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           +GS+ T+HAN+AR++ GR+E M+ M GF +P   +R  I S++D++VQ +RL DG RR+T
Sbjct: 321 EGSLTTLHANSARDALGRLEYMVCMAGFDMPVANIRTQIASAIDLVVQLERLEDGGRRVT 380

Query: 411 NICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +I EI GMEG +I   +L  ++  G +E G +IG+  +TGV  P F N+  Q+G
Sbjct: 381 SIQEINGMEGEIITMSELFHFQREGREENGDIIGKFSATGVI-PGFHNKLKQHG 433


>gi|113866738|ref|YP_725227.1| flp pilus assembly ATPase CpaF [Ralstonia eutropha H16]
 gi|113525514|emb|CAJ91859.1| flp pilus assembly ATPase CpaF [Ralstonia eutropha H16]
          Length = 456

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 296/407 (72%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y+++K  +  T+++ +++ +L++Y  +  R EIA L+N I+  +K+ ++ +E+  L  ++
Sbjct: 35  YHQLKRDVHETVLDRVELERLARYPQEQVRQEIAALVNLIIDEQKVLLNENERRQLTVEI 94

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+PL+    ++DI+VN + + ++E  GK   T + F D+  L+ V ++IV+
Sbjct: 95  YDEMFGFGPLEPLLHDPTVSDILVNTARQTYVERRGKLELTDVVFYDDAHLMKVIEKIVS 154

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DE+SP+ DARL DGSRVN IIPP A+DGP L+IR+F  + L +  LV+  ++T 
Sbjct: 155 RVGRRIDETSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFSVNPLQVSDLVNLRSLTP 214

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LLQ + + + NVL+SGGTGSGKTTLLN L+ +I +DER+VT ED AELQL+QPHV+
Sbjct: 215 PMAQLLQALSQAKVNVLVSGGTGSGKTTLLNILSGFIPEDERVVTIEDAAELQLRQPHVL 274

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 275 RLETRPPNIEGKGEITQRALVRNALRMRPDRIILGEVRGGEALDMLNAMNTGHEGSLTTI 334

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M++M G T+P++ +R+ I+S++ VIVQ  R+ DG R+I +I EI G
Sbjct: 335 HANTPRDALTRLENMVSMAGLTMPAKAMRQQISSAITVIVQAARMTDGRRKIISIQEITG 394

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D+ G + G   +TGV  P+F  R   +G
Sbjct: 395 MEGDIINMQEIFTFQRTGVDKDGTVRGNFRATGVY-PKFAERLRVFG 440


>gi|163751750|ref|ZP_02158968.1| putative pilus assembly protein [Shewanella benthica KT99]
 gi|161328402|gb|EDP99561.1| putative pilus assembly protein [Shewanella benthica KT99]
          Length = 441

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/414 (48%), Positives = 289/414 (69%), Gaps = 1/414 (0%)

Query: 51  FVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           F   T     +K  ++  L+ ++D++ +     + A+ +I  + +++++   + ++L  +
Sbjct: 12  FKQLTAEELHLKEQVYNKLLSVMDLSLIETISKEQAQQQINDICDQLITDLHLPINLSAR 71

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             L + + +++LG GPL+ L+A   I+DI+VN  N+V+IE  GK     I F +N  LL+
Sbjct: 72  QRLIKLIIDEVLGLGPLEVLLADPSISDILVNSYNRVYIERKGKLERVPIEFHNNAHLLN 131

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           +  RIV+ VGRR+DESSP+ DARL DGSRVN IIPPLALDGP L+IR+F  DK+  + L+
Sbjct: 132 IIDRIVSSVGRRIDESSPMVDARLADGSRVNAIIPPLALDGPALSIRRFAVDKMCAEELI 191

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G++T++   LL      + N+L+SGGTGSGKTTLLN L+ YI  DERIVT ED+AELQ
Sbjct: 192 EIGSMTSQMNELLSAAVAGKLNILVSGGTGSGKTTLLNMLSGYIPADERIVTIEDSAELQ 251

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L+QPH VRLETRP NIEG+GE++ RDLVKNCLRMRP+RI++GEVRG E LD+L AMNTGH
Sbjct: 252 LRQPHTVRLETRPANIEGKGEVSQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMNTGH 311

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           +GS+ T+HAN+AR++ GR+E M+ M GF +P   +R  I S++D++VQ  R+ DG RR+T
Sbjct: 312 EGSLTTLHANSARDALGRLEYMVCMAGFDIPVVNIRTQIASAIDLVVQLDRMEDGGRRVT 371

Query: 411 NICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +I EI GMEG +I   +L  ++  G D+ G +IG+  +TGV  P F N+  Q+G
Sbjct: 372 SIQEINGMEGEIITMSELFYFKREGRDQKGDIIGKFAATGVI-PGFHNKLKQHG 424


>gi|220918106|ref|YP_002493410.1| type II secretion system protein E [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955960|gb|ACL66344.1| type II secretion system protein E [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 445

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 286/402 (71%), Gaps = 1/402 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + ++K  +   L++ +D+  L +  ++  +DE+  ++  +VS   + ++  E+  L +++
Sbjct: 27  FRDMKGDLHRRLVDRLDLKALERLPAERLQDELRGIVAGMVSGAGVPLNQAERDRLVQEI 86

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+PL+A   I+DI+VN +  V++E NGK   T + F  N+ L+ V  RIV+
Sbjct: 87  LDEVTGLGPLEPLLADGSISDILVNTAETVYVERNGKLELTRVRFDSNDHLMQVINRIVS 146

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDE+SP+ DARL DGSRVN IIPPLA+DG  L+IR+F +  L +  L++ G+VT 
Sbjct: 147 RVGRRVDETSPMVDARLPDGSRVNAIIPPLAIDGAILSIRRFGRSPLRVRDLLTIGSVTR 206

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    L      R NVL+SGGTGSGKTT+LN L+ +I   ERIVT ED+AELQLQQPHVV
Sbjct: 207 EAVSFLAACVTARLNVLVSGGTGSGKTTMLNALSAFIPPSERIVTIEDSAELQLQQPHVV 266

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI  RDLV+N LRMRP+RII+GEVR  EVLD+LQAMNTGHDGSM TI
Sbjct: 267 RLETRPPNIEGKGEIIARDLVRNSLRMRPDRIIVGEVRSSEVLDMLQAMNTGHDGSMTTI 326

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+EAMIAMGG  LP    R++I+ ++++IVQ  R  DG RR+ ++ EI G
Sbjct: 327 HANSPRDALTRLEAMIAMGGIQLPEAASRQMISRAINIIVQLNRGADGHRRLVSVGEITG 386

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            EG  I  Q++ +++  G DE GK++GQ ++TG+ RP+  NR
Sbjct: 387 TEGPTITMQEIFRFDQKGVDERGKIVGQLVATGI-RPKVMNR 427


>gi|167579122|ref|ZP_02371996.1| type II secretion system protein [Burkholderia thailandensis TXDOH]
          Length = 455

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 292/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIA+L+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIASLIARILDEEKLLANDLERRQLTVDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPTVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV++  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNYQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G TLP + +R+ I+S++ V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVSGLTLPPKTMRQQISSAIAVVVQTSRLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D TG ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFMFKRTGLDATGNVLGYFTATGV-RPKFTERLNAFG 438


>gi|94309586|ref|YP_582796.1| type II secretion system protein E [Cupriavidus metallidurans CH34]
 gi|93353438|gb|ABF07527.1| flp pilus assembly ATPase CpaF [Cupriavidus metallidurans CH34]
          Length = 456

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/410 (47%), Positives = 293/410 (71%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P Y+ +K  +  T+++ +++ +L+ +  +  R EIA+L++ I+   K+ ++ +E+  L 
Sbjct: 32  SPGYHALKRDVHETVLDRVELERLAHFPQEQVRQEIASLVSLIIEEHKVLLNDNERRQLT 91

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ +++ G+GPL+PL+    ++DI+VN + + ++E  GK   T + F D+  L+ V ++
Sbjct: 92  VEIYDEMFGFGPLEPLLKDPTVSDILVNTARQTYVERRGKLELTNVVFYDDAHLMKVIEK 151

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV++VGRR+DE+SP+ DARL DGSRVN IIPP A+DGP L+IR+F  + L +  LV   +
Sbjct: 152 IVSRVGRRIDETSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFSVNPLQVSDLVELKS 211

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T   A++LQ +   + NVL+SGGTGSGKTTLLN L+ +I +DER+VT ED AELQL+QP
Sbjct: 212 LTQPMAQMLQALAHAKINVLVSGGTGSGKTTLLNILSGFIPEDERVVTIEDAAELQLRQP 271

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HV+RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGE+RG E LD+L AMNTGH+GS+
Sbjct: 272 HVLRLETRPPNIEGKGEITQRALVRNALRMRPDRIILGEIRGGEALDMLNAMNTGHEGSL 331

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN  R++  R+E M++M G T+P++ +R+ I S++ VIVQ  RL DG R+I +I E
Sbjct: 332 TTIHANTPRDALTRLENMVSMAGLTMPAKAMRQQIASAITVIVQAARLTDGRRKIISIQE 391

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG++I TQ++  ++  G  E G + G   +TGV  P+F  R   +G
Sbjct: 392 ITGMEGDIINTQEIFTFQRTGVAEDGTVRGHFKATGVY-PKFAERLRVFG 440


>gi|294012673|ref|YP_003546133.1| archaeal flagellar protein FlaI [Sphingobium japonicum UT26S]
 gi|292676003|dbj|BAI97521.1| archaeal flagellar protein FlaI [Sphingobium japonicum UT26S]
          Length = 508

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 294/414 (71%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +        +E   ++ E+++  K+T++  EQ  L + L 
Sbjct: 94  HKIKEQVLPRLLERVDPEAAATLTKDELAEEFRPIIMEVLAELKLTLNRREQFALEKVLV 153

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG GPL+ L+A  D++DIMVNG  + +IE  GK     I FRD E L  + QRIVN+
Sbjct: 154 DELLGLGPLEELLADPDVSDIMVNGPEQTYIEKKGKLQIAPIKFRDEEHLFQIAQRIVNK 213

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF    +TLD L  +GA++ +
Sbjct: 214 VGRRVDQTTPLADARLPDGSRVNVIVPPLSLRGTAISIRKFSAKPITLDMLAQWGAMSQK 273

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
               L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 274 MCTALKIAGACRFNIVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLP 333

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 334 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLH 393

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           +N+ RE  GRME MI MG   +P + + + I  S+D+IVQ +RLRDGSRR+TN+ E++GM
Sbjct: 394 SNSPRECLGRMENMILMGDIKIPKEAISKQIADSVDLIVQVKRLRDGSRRVTNVTEVIGM 453

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG+VI+TQ+L K+E   ED++GK+IG++ S G+ RP   ++A Q+G ++   E 
Sbjct: 454 EGDVIVTQELFKFEYHDEDDSGKIIGEYRSMGL-RPYTLDKARQFGFDQPFLEA 506


>gi|167836686|ref|ZP_02463569.1| component of type IV pilus [Burkholderia thailandensis MSMB43]
          Length = 475

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/483 (43%), Positives = 309/483 (63%), Gaps = 17/483 (3%)

Query: 1   MFGRRDKKLMGSVKRE------DNNPL--PQEVVVSSSNIQKQNLQSSSPSAEGEIGNFV 52
           MFGRR K    S   E      D  P   P ++  S SN+ +   Q     A+G+    +
Sbjct: 2   MFGRRIKLPTASPLAETPSAGADERPADAPLKIAPSPSNVPRAAPQPQP--ADGD--EAL 57

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
            R+  +  +++ + +++    +++          R+ +  +  E++   ++ ++L EQ+ 
Sbjct: 58  IRSDTFRTIRTAVLSSM----NLSAALMMPRAQVREGVERVAREVIMRDRLAVTLAEQVR 113

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + +++ ND+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRDN  +++V 
Sbjct: 114 IVDEILNDMFGVGPIEPLLADESVTDILVNGPDQVYVERGGRLELTPLKFRDNTHVVNVA 173

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   
Sbjct: 174 QRIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQ 233

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G ++     +L+I    R N++ISGGTGSGKTTLLN L+ YID+ ER+VT ED AELQLQ
Sbjct: 234 GNISPAMVNVLKIASACRLNIVISGGTGSGKTTLLNALSHYIDEHERVVTIEDAAELQLQ 293

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVV LETRP N EG G +T RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDG
Sbjct: 294 QPHVVSLETRPENSEGLGGVTQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDG 353

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M    LP   +R  I S++ +IV  +R+RDG+RR+T++
Sbjct: 354 SMTTVHANTPRDAITRLESMVMMANANLPLVAIRRQIASAVHMIVHIERMRDGTRRVTHV 413

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
            EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L E 
Sbjct: 414 TEIAGMEGDVVITQDLFTFRYDTSAYQDQVRGMFESSSL-RPAFTARAAYYGFENALLEA 472

Query: 473 LQS 475
           +Q+
Sbjct: 473 IQA 475


>gi|207728103|ref|YP_002256497.1| secretion atpase protein [Ralstonia solanacearum MolK2]
 gi|206591348|emb|CAQ56960.1| secretion atpase protein [Ralstonia solanacearum MolK2]
          Length = 454

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 285/416 (68%), Gaps = 1/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G   + +  Y +V   +   +I+ +++ +L Q      + E+A L+  IV   K  ++  
Sbjct: 24  GAAASTSAAYQQVAMDVHQIIIDRVELGRLQQLTPDQVKRELAQLVERIVDEGKHQLNEV 83

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+ +++LGYGPL+PL+A   I+DI+VN   +V++E  GK   T + F D+  L
Sbjct: 84  ERRRLVSDVQDEMLGYGPLEPLLADPTISDILVNTYQRVYVERRGKLELTTVTFHDDAHL 143

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + V +++V++VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT++ 
Sbjct: 144 MRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIED 203

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+ F  +T E A+LL  + + + N+LISGGTGSGKTTLLN L+ YI  DERIVT ED AE
Sbjct: 204 LIGFRTLTPEMAQLLDAMVKAKLNILISGGTGSGKTTLLNILSGYIPADERIVTIEDAAE 263

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HV+RLETRP NIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNT
Sbjct: 264 LQLRQNHVLRLETRPANIEGRGEITQRSLVKNALRMRPDRIILGEVRGAEALDMLHAMNT 323

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ TIHAN  R++  R+E MI+M G +LP +  R+ ITS+L V+VQ  RL DG R+
Sbjct: 324 GHEGSLATIHANTPRDALTRLENMISMAGLSLPPKTTRQQITSALTVVVQVSRLTDGYRK 383

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + ++ EI GMEG V+  Q++  +   G D  G++ G   +TGV RP+F  R   +G
Sbjct: 384 LVSVQEITGMEGEVVNMQEIFAFRRKGIDRDGRIKGHFCATGV-RPKFSERLQAFG 438


>gi|307294134|ref|ZP_07573978.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
 gi|306880285|gb|EFN11502.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
          Length = 508

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/414 (50%), Positives = 294/414 (71%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +        +E   ++ E+++  K+T++  EQ  L + L 
Sbjct: 94  HKIKEQVLPRLLERVDPEAAATLTKDELAEEFRPIILEVLAELKLTLNRREQFALEKVLV 153

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG GPL+ L++  D+ DIMVNG  + +IE  GK     I FRD E L  + QRIVN+
Sbjct: 154 DELLGLGPLEELLSDPDVTDIMVNGPEQTYIEKKGKLQIAPIKFRDEEHLFQIAQRIVNK 213

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF    +TLD+L  +GA++ +
Sbjct: 214 VGRRVDQTTPLADARLPDGSRVNVIVPPLSLRGTAISIRKFSAKPITLDNLAQWGAMSQK 273

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
               L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 274 MCTALKIAGACRMNIVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLP 333

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 334 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLH 393

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           +N+ RE  GRME MI MG   +P + + + I  S+D+IVQ +RLRDGSRR+TNI E++GM
Sbjct: 394 SNSPRECLGRMENMILMGDIKIPKEAISKQIADSVDLIVQVKRLRDGSRRVTNITEVIGM 453

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG+VI+TQ+L K+E   ED++GK+IG++ S G+ RP   ++A Q+G ++   E 
Sbjct: 454 EGDVIVTQELFKFEYHDEDDSGKIIGEYRSMGL-RPYTLDKARQFGFDQPFLEA 506


>gi|94495680|ref|ZP_01302260.1| type II secretion system protein E [Sphingomonas sp. SKA58]
 gi|94425068|gb|EAT10089.1| type II secretion system protein E [Sphingomonas sp. SKA58]
          Length = 511

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/414 (50%), Positives = 293/414 (70%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +        +E   ++ E+++  K+T++  EQ  L + L 
Sbjct: 97  HKIKEQVLPRLLERVDPEAAATLTKDELAEEFRPIIMEVLAELKLTLNRREQFALEKVLV 156

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG GPL+ L++  D+ DIMVNG  + +IE  GK     I FRD E L  + QRIVN+
Sbjct: 157 DELLGLGPLEELLSDPDVTDIMVNGPEQTYIEKKGKLQVAPIKFRDEEHLFQIAQRIVNK 216

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF    +T+D L  +GA++ +
Sbjct: 217 VGRRVDQTTPLADARLPDGSRVNVIVPPLSLRGTAISIRKFSAKPITIDMLAQWGAMSPK 276

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A  L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + 
Sbjct: 277 MATALKIAGACRFNIVISGGTGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLP 336

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRPPN+EG+G IT+ DLVKN LRMRP+RIILGE+RG E  DLL AMNTGHDGSM T+H
Sbjct: 337 LETRPPNLEGQGAITIGDLVKNALRMRPDRIILGEIRGAECFDLLAAMNTGHDGSMCTLH 396

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+ RE  GRME MI MG   +P + + + I  S+D+IVQ +RLRDGSRR+TN+ E++GM
Sbjct: 397 ANSPRECLGRMENMILMGDIKIPKEAISKQIADSVDLIVQVKRLRDGSRRVTNVTEVIGM 456

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG+VI+TQ+L K+E   ED++GK++G++ S G+ RP   ++A  +G ++   E 
Sbjct: 457 EGDVIVTQELFKFEYHDEDDSGKIVGEYRSMGL-RPYTLDKARMFGFDQPFLEA 509


>gi|73542332|ref|YP_296852.1| type II secretion system protein E [Ralstonia eutropha JMP134]
 gi|72119745|gb|AAZ62008.1| type II secretion system protein E [Ralstonia eutropha JMP134]
          Length = 459

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 294/410 (71%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P Y+ +K  +   +++ +++ +L+++  +  R EI+TL+N I+  +++ ++ +E+  L 
Sbjct: 35  SPGYHALKREVHEVVLDRVELERLARFPQEQVRQEISTLVNLIIDEQRVLLNDNERRQLT 94

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ +++ G+GPL+PL+    ++DI+VN   + ++E  GK   T + F D+  L+ V ++
Sbjct: 95  VEIYDEMFGFGPLEPLLKDPTVSDILVNTGRQTYVERRGKLELTDVVFYDDAHLMKVIEK 154

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV++VGRR+DE+SP+ DARL DGSRVN IIPP A+DGP L+IR+F  + L +  LV   +
Sbjct: 155 IVSRVGRRIDETSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFSVNPLQVSDLVELRS 214

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T   A++LQ + + + NVL+SGGTGSGKTTLLN L+ +I +DER++T ED AELQL+QP
Sbjct: 215 LTPPMAQMLQALSKAKVNVLVSGGTGSGKTTLLNILSGFIPEDERVITIEDAAELQLRQP 274

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HV+RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+
Sbjct: 275 HVLRLETRPPNIEGKGEITQRALVRNALRMRPDRIILGEVRGGEALDMLNAMNTGHEGSL 334

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN  R++  R+E M++M G T+P++ +R+ I S++ VIVQ  RL DG R+I +I E
Sbjct: 335 TTIHANTPRDALTRLENMVSMAGLTMPAKAMRQQIASAITVIVQAARLTDGRRKIISISE 394

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG++I  Q++  ++  G D+ G + G   +TGV  P+F  R   +G
Sbjct: 395 ITGMEGDIINMQEIFTFQRTGVDKDGTVRGHFRATGVY-PKFAERLRVFG 443


>gi|83716156|ref|YP_440462.1| type II secretion system protein [Burkholderia thailandensis E264]
 gi|167617237|ref|ZP_02385868.1| type II secretion system protein [Burkholderia thailandensis Bt4]
 gi|257141110|ref|ZP_05589372.1| type II secretion system protein [Burkholderia thailandensis E264]
 gi|83649981|gb|ABC34045.1| type II secretion system protein [Burkholderia thailandensis E264]
          Length = 455

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/407 (48%), Positives = 291/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  +   ++E +++ +LS+  ++  R+EIA+L+  I+  +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQMHGAVLERVELERLSRLPAEQVRNEIASLIARILDEEKLLANDLERRQLTVDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN ++ V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPTVSDILVNTASAVYVERYGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV++  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVNYQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + R + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALARAKVNVLVSGGTGSGKTTLLNILSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G TLP + +R+ I+S++ V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVSGLTLPPKTMRQQISSAIAVVVQTSRLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D  G ++G   +TGV RP+F  R   +G
Sbjct: 393 MEGEIINMQEIFMFKRTGLDANGNVLGYFTATGV-RPKFTERLNAFG 438


>gi|194288830|ref|YP_002004737.1| tad secretion sytem protein, secretion atpase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193222665|emb|CAQ68668.1| Tad secretion sytem protein, secretion ATPase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 456

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 293/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y+++K  +  T+++ +++ +L++Y  +  R EI  L+N IV  +K+ ++  E+  L  ++
Sbjct: 35  YHQLKRDVHETVLDRVELERLARYPQEQVRQEITALVNLIVDEQKVLLNDTERRQLTVEI 94

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+PL+    ++DI+VN + + ++E  GK   T + F D+  L+ V ++IV+
Sbjct: 95  YDEMFGFGPLEPLLKDPTVSDILVNTARQTYVERRGKLELTDVVFYDDAHLMKVIEKIVS 154

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DE+SP+ DARL DGSRVN IIPP A+DGP L+IR+F  + L +  LV+  ++T 
Sbjct: 155 RVGRRIDETSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFAVNPLQVADLVNLRSLTP 214

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LLQ + + + NVL+SGGTGSGKTTLLN L+ +I +DER+VT ED AELQL+QPHV+
Sbjct: 215 PMAQLLQALSQAKVNVLVSGGTGSGKTTLLNILSGFIPEDERVVTIEDAAELQLRQPHVL 274

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 275 RLETRPPNIEGKGEITQRALVRNALRMRPDRIILGEVRGGEALDMLNAMNTGHEGSLTTI 334

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M++M G T+P++ +R+ I S++ VIVQ  R+ DG R+I +I EI G
Sbjct: 335 HANTPRDALTRLENMVSMAGLTMPAKAMRQQIASAITVIVQAARMTDGRRKIISIQEITG 394

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D+ G + G   +TGV  P+F  R   +G
Sbjct: 395 MEGDIINMQEIFTFQRTGVDKDGTVRGNFRATGVY-PKFAERLRVFG 440


>gi|149911403|ref|ZP_01900021.1| putative pilus assembly protein [Moritella sp. PE36]
 gi|149805511|gb|EDM65516.1| putative pilus assembly protein [Moritella sp. PE36]
          Length = 441

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/414 (49%), Positives = 286/414 (69%), Gaps = 1/414 (0%)

Query: 51  FVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           F   T    E K  IF  L+  +D++ L     + A+++IA    + ++ +   +SLD +
Sbjct: 12  FSMLTASDMETKQEIFGQLLTQLDLSVLETLPPEIAKEKIANSCYQFLNKQTRPISLDVR 71

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             L + + ++ILG GPL+ L+    IADI+VN  +++F+E NGK  +  + F D++ LL+
Sbjct: 72  QVLIKLITDEILGLGPLETLLEDPTIADILVNSYDRIFVERNGKLEQVSVQFYDDKHLLN 131

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           +  RIV+ VGRR+DESSP+ DARL DGSR+N IIPPLALDGP L+IR+F  DKL    L+
Sbjct: 132 IIDRIVSGVGRRIDESSPMVDARLKDGSRINAIIPPLALDGPALSIRRFTVDKLQAQQLI 191

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
            +G++T   A L+Q     + N+LISGGTGSGKTTLLN L+ YI  +ERI+T ED+AELQ
Sbjct: 192 DYGSMTQPMADLIQAAVLGKLNILISGGTGSGKTTLLNILSGYIPDNERIITIEDSAELQ 251

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           LQQPH VRLETRP NIEG+GE+T R+LVKNCLRMRP+RI++GEVRG E +D+L AMNTGH
Sbjct: 252 LQQPHTVRLETRPANIEGKGEVTQRELVKNCLRMRPDRIVIGEVRGSEAIDMLAAMNTGH 311

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           +GSM T+HAN  R+  GR+E MI M GF +P   +R  I+S++DV+VQ QR  DG RRIT
Sbjct: 312 EGSMTTLHANTPRDGLGRLENMICMAGFDMPIHNIRTQISSAIDVVVQLQRQEDGKRRIT 371

Query: 411 NICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +I E+ GMEG++I   ++  +   G++E G + G++ +TGV  P F  +    G
Sbjct: 372 SIQEVTGMEGDMITMSEIFTFRREGKNEDGSIKGRYAATGVV-PTFARKLKDKG 424


>gi|187927684|ref|YP_001898171.1| type II secretion system protein E [Ralstonia pickettii 12J]
 gi|187724574|gb|ACD25739.1| type II secretion system protein E [Ralstonia pickettii 12J]
          Length = 454

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/409 (47%), Positives = 287/409 (70%), Gaps = 1/409 (0%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           P Y + K T+   +++ +D+ +L+++  +  R EI TL+N I+  +K+ ++  E+  +  
Sbjct: 31  PAYRDFKKTVHEVVLDRVDLERLARFPIEQVRHEIGTLVNNIIDEEKLLLNDTERRQMTT 90

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+ +++ G+GPL+PL+    ++DI+VN + +V++E  GK   T + F D+  L+ V ++I
Sbjct: 91  DVYDEMFGFGPLEPLLQDPTVSDILVNTAKQVYVERRGKLELTDVTFYDDAHLMKVIEKI 150

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V++VGRR+DE+SP+ DARL DGSRVN IIPP A+DGP L+IR+F  + L +  L+    +
Sbjct: 151 VSRVGRRIDETSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFATNPLQVSDLIDLKTL 210

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T   A+L+Q + + + NVL+SGGTGSGKTTLLN L+ +I  DER+VT ED AELQL+QPH
Sbjct: 211 TPPMAKLMQALSQAKVNVLVSGGTGSGKTTLLNILSGFIPADERMVTIEDAAELQLRQPH 270

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           V+RLETRPPNIEG+GEIT R LV+N LRMRP+RI+LGEVRG E LD+L AMNTGH+GS+ 
Sbjct: 271 VLRLETRPPNIEGKGEITQRALVRNALRMRPDRILLGEVRGGEALDMLNAMNTGHEGSLT 330

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HAN  R++  RME M+ M G  LP + +R+ I S++ VI+Q  RL DG R++ +I EI
Sbjct: 331 TVHANTPRDALTRMENMVNMAGLNLPPKTIRQQIASAITVIIQVARLTDGRRKVISIQEI 390

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            GMEG+VI  Q++  ++  G  + G + G   +TGV  P+F  R   +G
Sbjct: 391 TGMEGDVINMQEIFTFQRTGIAQDGSVKGHFRATGVY-PKFAERLRVFG 438


>gi|17545371|ref|NP_518773.1| secretion ATPase [Ralstonia solanacearum GMI1000]
 gi|17427663|emb|CAD14182.1| probable secretion atpase protein [Ralstonia solanacearum GMI1000]
          Length = 453

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/410 (49%), Positives = 290/410 (70%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P Y ++   I  T+I+ +++++L Q   +  R E+A L+  IV      ++  E+  L 
Sbjct: 29  SPAYQQLAIEIHQTIIDRVELSRLQQLTPEQVRRELAQLVERIVEEGNHPVNEAERHRLV 88

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            D+ +++LGYGPL+PL+A   I+DI+VN   +V++E  GK   T + F ++  L+ V ++
Sbjct: 89  SDVQDEMLGYGPLEPLLADPTISDILVNTCKQVYVERRGKLELTDVTFHNDAHLMRVIEK 148

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           +V+++GRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+  L+ +  
Sbjct: 149 MVSRMGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTVKDLIEYNT 208

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T + A+LL+ + + + N+LISGGTGSGKTTLLN L+ YI  DER+VT ED AELQL+QP
Sbjct: 209 LTPQMAQLLEAMVQAKLNILISGGTGSGKTTLLNILSGYIPVDERVVTIEDAAELQLRQP 268

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HV+RLETRPPNIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNTGH+GS+
Sbjct: 269 HVLRLETRPPNIEGRGEITQRSLVKNALRMRPDRIILGEVRGAEALDMLHAMNTGHEGSL 328

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN  R++  R+E M++M G  LP++ +R+ ITS+L V+VQ  RL DG R++ ++ E
Sbjct: 329 ATIHANTPRDALTRLENMVSMSGLQLPTKTMRQQITSALSVVVQVTRLTDGRRKLVSVQE 388

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG+++  Q++  +   G D  G++ G   +TGV RP+F  R   YG
Sbjct: 389 ITGMEGDIVNMQEIFTFRRRGVDRDGRIKGHFCATGV-RPKFSERLQSYG 437


>gi|312883311|ref|ZP_07743037.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368927|gb|EFP96453.1| Flp pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 421

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 293/417 (70%), Gaps = 5/417 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF    + ID+  L++        ++ + +N ++  + + +S  ++ +L   L
Sbjct: 8   YIKIRDEIF----DAIDVGTLAESSRMELSQQLMSSVNLLIESRDLQVSNQQRQNLVNAL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  DDI+DIM+NG   VFIE+NGK  ++ + F + EQL+++ +RI +
Sbjct: 64  VDELKGLGPLQALVNNDDISDIMINGPFNVFIEINGKVEKSPVQFINEEQLITIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+D+S P+CDARL DGSRVN++IPPLA+DG +++IRKFK+ K+ L++LV FGA++ 
Sbjct: 124 DVGRRIDDSKPLCDARLADGSRVNIVIPPLAIDGTSISIRKFKEQKIKLENLVDFGALSV 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A++L I    +CN+LISGGTGSGKTTLLN L+ +I + ER+VT ED AELQLQQPH+V
Sbjct: 184 DMAKILSIASHCKCNILISGGTGSGKTTLLNALSGFIGEGERVVTIEDAAELQLQQPHIV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR  ++EG GEI+ R+LV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRQASVEGTGEISARELVINSLRMRPDRIIVGECRGAEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R E+M+ M    LP   +R  I S++D+IVQ +RL DGSR++  I E+VG
Sbjct: 304 HANTPRDAIARTESMVMMATSNLPIAAIRRSIVSAVDLIVQVRRLHDGSRKVMYISEVVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPR-FWNRAAQYGEEKNLAEVL 473
           MEG+ ++ +D+ +++     E G++ G+  S+G+S+    + RA  +G E  + ++ 
Sbjct: 364 MEGDNVVMEDIFRFDAAPTLEEGRISGKFHSSGLSKNSVIYQRARYFGLESTVRDIF 420


>gi|78060308|ref|YP_366883.1| Flp pilus assembly protein ATPase CpaF [Burkholderia sp. 383]
 gi|77964858|gb|ABB06239.1| Flp pilus assembly protein ATPase CpaF [Burkholderia sp. 383]
          Length = 455

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 287/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+   +S R EI  L+  I+  +++  +  E+  L  D+
Sbjct: 33  YQKLRREIHLAVLERVELERLSRMPQESVRMEIGLLITRILDEERLPANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLEALLRDPSISDILVNTYRQVYVERFGQLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV + ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRYHSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ YI ++ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLDALSRAKINVLVSGGTGSGKTTLLNILSGYIPRNERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMISVSGLTLPPKTMRQQIASAISVVVQAARLTDGRRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++ MG D  G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGDIINMQEIFTFKRMGVDRDGTVRGHFCATGV-RPKFVERLQAFG 438


>gi|325108939|ref|YP_004270007.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
 gi|324969207|gb|ADY59985.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
          Length = 442

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/407 (49%), Positives = 280/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K  I + L++ +D+T+L      + R EI  ++  +   +   ++  E+  L E++
Sbjct: 22  FETLKRLIHSKLVDKLDLTRLGDLQGDTLRREIRLVVEHLCDTENPLLNRSERERLIEEV 81

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G+GPL+ L+  DD+ADIM+NG   VFIE  G+  ++ + FRDN  LL +  RIV+
Sbjct: 82  LDETFGFGPLEILMKMDDVADIMINGPKNVFIEKAGRIQKSEVTFRDNAHLLQILDRIVS 141

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDES+P+ DARL DGSR+N +IPPLALDGP+LTIRKF    LTL+ L++FGA T 
Sbjct: 142 RVGRRVDESNPMVDARLPDGSRLNAVIPPLALDGPSLTIRKFGSSPLTLEKLLNFGAFTP 201

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A  L+   + R N +ISGGTGSGKTTLLN L+ +I  D RI+T ED AELQLQQ HV+
Sbjct: 202 EMAMFLEGATKARLNTIISGGTGSGKTTLLNTLSSFIQNDHRIITIEDAAELQLQQEHVL 261

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP +IEG+G +T  DLVKN LRMRP+RII+GE RG E LD+LQAMNTGH+GS+ T+
Sbjct: 262 RLETRPASIEGKGRVTATDLVKNALRMRPDRIIIGECRGAETLDMLQAMNTGHEGSLTTV 321

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HANN R++  RME MI+MGG  LP + +R+  ++++D+I+Q  RL+ G R++T+I E++ 
Sbjct: 322 HANNPRDAVSRMETMISMGGIELPIKAIRQQFSAAVDIIIQASRLQGGPRKVTHITEVLN 381

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           ME + II QD+  +   G D  G+  G   STGV RP    R    G
Sbjct: 382 MEQDTIIMQDIFLFVQDGIDSDGRAYGHFESTGV-RPNCMKRLEAAG 427


>gi|167566941|ref|ZP_02359857.1| type II secretion system protein [Burkholderia oklahomensis EO147]
 gi|167574010|ref|ZP_02366884.1| type II secretion system protein [Burkholderia oklahomensis C6786]
          Length = 455

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 288/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+  ++  R EIATL+  I   +K+  +  E+  L  D+
Sbjct: 33  YQKLRRQIHGAVLERVELERLSRMPAEQVRTEIATLITRIFDEEKLLANDLERRQLTIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN S  V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPTVSDILVNTSRSVYVERFGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D L+++ ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLINYQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ +   + NVL+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQLQQ HV+
Sbjct: 213 PMAQLLEALACAKVNVLLSGGTGSGKTTLLNVLSGFIPDDERIVTIEDAAELQLQQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI + G +LP + +R+ I S+L V+VQT RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMIGVAGLSLPPKTMRQQICSALSVVVQTARLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  ++  G D  G ++G   STGV RP+F  R + +G
Sbjct: 393 MEGEIINMQEIFTFKRTGLDANGNVLGYFTSTGV-RPKFAERLSAFG 438


>gi|170700846|ref|ZP_02891835.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
 gi|172065279|ref|YP_001815991.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
 gi|170134254|gb|EDT02593.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
 gi|171997521|gb|ACB68438.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
          Length = 455

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 290/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I  T+++ +++ +LS+   +  R EI++L++ I+  +++  +  E+  L  D+
Sbjct: 33  YQKLRREIHLTVLDRVELERLSRLPQEQVRQEISSLISRILDEERLLANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E +G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPGISDILVNTYRQVYVERSGQLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES+P+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LVS+ ++T 
Sbjct: 153 RVGRRIDESTPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVSYQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  +   + NVL+SGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLDALAHAKVNVLVSGGTGSGKTTLLNILSGFIPRSERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++GG TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMISVGGLTLPPKTMRQQIASAISVVVQATRLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D  G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGDIINMQEIFTFKRTGMDRDGTVRGHFCATGV-RPKFAERLQAFG 438


>gi|212635451|ref|YP_002311976.1| pilus assembly protein [Shewanella piezotolerans WP3]
 gi|212556935|gb|ACJ29389.1| Pilus assembly protein, putative [Shewanella piezotolerans WP3]
          Length = 443

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/405 (48%), Positives = 287/405 (70%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           ++K  ++  L+ ++D++ +     + A  +I+ +  +++S  ++ ++L  +  L + + +
Sbjct: 23  DIKIQLYDKLLSVMDLSLIETVSKEQAEIQISQICEKLLSEMRLPINLSSRKRLIKLIID 82

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++LG GPL+ L+A   I+DI+VN  ++V++E  GK     I F  N  LL++  RIV+ V
Sbjct: 83  EVLGLGPLEILLADPSISDILVNSYDRVYVERKGKLQSVNIKFHSNAHLLNIIDRIVSSV 142

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F  DKL    L+  G+VT E 
Sbjct: 143 GRRIDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFAVDKLNAKQLIDIGSVTEEM 202

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             LLQ   + + N+L+SGGTGSGKTTLLN L+ YI  DERIVT ED+AELQLQQPH VRL
Sbjct: 203 IELLQGSVKGKLNILVSGGTGSGKTTLLNMLSGYIPPDERIVTIEDSAELQLQQPHTVRL 262

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP NIEG+GE++ RDLVKNCLRMRP+RI++GEVRG E LD+L AMNTGH+GS+ T+HA
Sbjct: 263 ETRPQNIEGKGEVSQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMNTGHEGSLTTLHA 322

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ R++ GR+E M+ M GF +P   +R  + S++D++VQ +R  DG RR+T+I EI GME
Sbjct: 323 NSPRDALGRLEYMVCMAGFDMPVSNIRTQVASAIDLVVQLERQEDGRRRVTSIQEINGME 382

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G +I   ++ ++   G  E G+++G+  +TGV  P F ++  Q+G
Sbjct: 383 GEIITMSEIFRFSRSGMKEGGEIVGEFEATGVI-PSFHSKLKQHG 426


>gi|297618078|ref|YP_003703237.1| type II secretion system protein E [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145915|gb|ADI02672.1| type II secretion system protein E [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 450

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 289/418 (69%), Gaps = 8/418 (1%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLS------QYDSQSARDEIATLMNEIVSVKKITMS 106
            R PH   V+  I   +I+ ID   L       + D +  R E+  +   ++  +   + 
Sbjct: 24  TRDPHQDLVQ-LIHREVIKEIDSEFLKSRSNGGETDDEQIRQEVKRIAEAVLDREGGVLL 82

Query: 107 LDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNE 166
             E+  +   + ++ILG+GP+ PL+  +D+++IMVNG ++V++E  GK     I FRD+E
Sbjct: 83  RVERERIMAQVLDEILGFGPITPLLEDEDVSEIMVNGPHQVYVERKGKLEPVNIGFRDDE 142

Query: 167 QLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTL 226
            +L V ++I++ +GRR+DES P+ DARL DGSRVN IIPPLAL+GP LTIRKF  D LT+
Sbjct: 143 HVLHVIEKIISPLGRRIDESMPMVDARLPDGSRVNAIIPPLALNGPVLTIRKFGSDPLTI 202

Query: 227 DHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT 286
           + L+ FG +T   A+LL+   + R N+++SGGTG+GKT+ LN L+ +I  DERI+T ED 
Sbjct: 203 EDLIRFGTLTPAMAKLLEACVKGRLNIVVSGGTGAGKTSTLNVLSSFIPGDERIITIEDA 262

Query: 287 AELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAM 346
           AELQL Q HVV LETRPPNIEG+G I +RDLV+N LRMRP+RI++GEVRG E LD+LQAM
Sbjct: 263 AELQLSQEHVVSLETRPPNIEGKGAIAIRDLVRNALRMRPDRIVVGEVRGGEALDMLQAM 322

Query: 347 NTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS 406
           NTGHDGS+ T H+N+ R+   R+E M+ M G  LP + +RE I S+LD+IV   R++DG+
Sbjct: 323 NTGHDGSLTTGHSNSPRDMISRLETMVLMAGMELPVKAIREQIASALDLIVHQARMKDGT 382

Query: 407 RRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           R+IT+I E+ GMEG+V++ QD+  +E  G D  G+++G+H +TG+ RPRF ++ A  G
Sbjct: 383 RKITHITEVTGMEGDVVVLQDIFVFEQTGVDAKGRVLGRHRATGI-RPRFLDKLAAAG 439


>gi|148655423|ref|YP_001275628.1| type II secretion system protein E [Roseiflexus sp. RS-1]
 gi|148567533|gb|ABQ89678.1| type II secretion system protein E [Roseiflexus sp. RS-1]
          Length = 463

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/410 (50%), Positives = 288/410 (70%), Gaps = 6/410 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E++  +   LI  +D  +L   +    R ++  + N I+  + I +S  E+  LFE +  
Sbjct: 46  ELRQRVQQRLINELD-PKLDLSNVARVRQQVEEIFNTILDSENIVLSRSERARLFESIAA 104

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           DILG+GPLQ L+   +I++IMVNG  KV++E  GK   T + F D + +L V  RIV  +
Sbjct: 105 DILGFGPLQELLNDPEISEIMVNGPKKVYVEKRGKIQLTDVTFVDEQHVLRVIDRIVAPL 164

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVN +I P+AL GPT++IRKF+K+ +T+D L+ FG++T+E 
Sbjct: 165 GRRIDESSPMVDARLPDGSRVNAVIRPIALCGPTISIRKFRKEGITIDDLIRFGSLTSEM 224

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  L    R   N+++SGGTGSGKTT+LN L+ +I  DERI+T E+ AELQL+Q HVV L
Sbjct: 225 AEFLSACVRASLNIVVSGGTGSGKTTMLNVLSSFIPDDERIITVENAAELQLRQEHVVPL 284

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GEI++RDLV N LRMRPERI++GE RG E L++LQAMNTGHDGSM T+HA
Sbjct: 285 ESRPPNVEGKGEISIRDLVINTLRMRPERIVVGECRGGEALEMLQAMNTGHDGSMTTLHA 344

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ R++  R+E M  M G  LP + +RE I S++++IVQ  RL+DGSR++  I E+ GME
Sbjct: 345 NSPRDAIARIETMCLMAGMDLPVRAIREQIASAVNLIVQLARLKDGSRKVIYITEVQGME 404

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNL 469
           G+V++  D+  +E  G DE GK+IGQ   TG+ RPRF +R     EE+N+
Sbjct: 405 GDVVVLSDIFVFEQQGLDERGKIIGQLKPTGI-RPRFIDRF----EERNI 449


>gi|317154602|ref|YP_004122650.1| type II secretion system protein E [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944853|gb|ADU63904.1| type II secretion system protein E [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 476

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/411 (49%), Positives = 280/411 (68%), Gaps = 3/411 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLF 114
           HY+E+K+ I   LI+MID++ L        R E+A +   ++    +   ++L E+  + 
Sbjct: 50  HYFEIKTRIHDRLIDMIDLSLLDALGEADMRAEVARVAEGLLWEEFQNAPLNLAERKRML 109

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ ++++G GPL+P I    + DI+VNG  +V++E  GK   T   F+D+  L  +  R
Sbjct: 110 SEIQDEVIGLGPLEPYIKDPTVNDILVNGYRQVYVERAGKLELTPARFKDDNHLRRIIDR 169

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+ VGRR+DES P+ DARLLDGSRVN IIPPLA+DGP+L+IRKF KD L    L++F +
Sbjct: 170 IVSLVGRRIDESQPLVDARLLDGSRVNAIIPPLAIDGPSLSIRKFSKDPLETSDLIAFNS 229

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T   A L+  I + R NV+ISGGTGSGKTTLLNCL+R I +DERIVT ED AELQL+Q 
Sbjct: 230 LTQPMAELMDGIVKARLNVVISGGTGSGKTTLLNCLSRSIPEDERIVTIEDAAELQLKQD 289

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRP NIEG GEI  R+LVKNCLRMRP+RIILGEVR  E LD+LQAMNTGHDGS+
Sbjct: 290 HVVRLETRPANIEGRGEIGQRELVKNCLRMRPDRIILGEVRASEALDMLQAMNTGHDGSL 349

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T+HAN  R++  R+E M++M G  L    ++  I+S+++VI+Q  RL DG+R++ +I E
Sbjct: 350 TTVHANTPRDALMRLETMVSMAGLNLSPISMKRYISSAIEVIIQATRLVDGTRKVISIQE 409

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGE 465
           + GMEG +I  Q++  +E       GK+ G   + G+ RPRF  +  + G 
Sbjct: 410 VTGMEGEMITMQEIFAFEQTNVSAEGKVEGYFTARGI-RPRFAQKLERMGH 459


>gi|115361039|ref|YP_778176.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
 gi|115286367|gb|ABI91842.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
          Length = 455

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 290/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I  T+++ +++ +LS+   +  R EI++L++ I+  +++  +  E+  L  D+
Sbjct: 33  YQKLRREIHLTVLDRVELERLSRLPQEQVRQEISSLISRILDEERLLANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E +G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPGISDILVNTYRQVYVERSGQLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES+P+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV++ ++T 
Sbjct: 153 RVGRRIDESTPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVAYQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  +   + NVL+SGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLDALAHAKVNVLVSGGTGSGKTTLLNILSGFIPRSERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++GG TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMISVGGLTLPPKTMRQQIASAISVVVQATRLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D  G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGDIINMQEIFTFKRTGMDRDGTVRGHFCATGV-RPKFAERLQAFG 438


>gi|167584964|ref|ZP_02377352.1| type II secretion system protein E [Burkholderia ubonensis Bu]
          Length = 455

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 291/425 (68%), Gaps = 3/425 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+   +  R EI+ L+  I+   K+  +  E+  L  D+
Sbjct: 33  YQKLRREIHAAVLERVELERLSRLPQEQVRHEISMLIARILDEDKLPANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN   +V++E +G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLESLLRDPSVSDILVNTYKQVYVERHGQLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F    L +D LV F ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVCPLKMDDLVRFQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I  +ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLDALSRAKVNVLVSGGTGSGKTTLLNILSGFIPPNERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G +LP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMISIAGLSLPPKTMRQQIASAISVVVQAARLTDGKRKIVSISELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           MEG++I  Q++  +   G D+ G + G   +TGV RP+F +R   +G   NL + L    
Sbjct: 393 MEGDIINMQEIFTFRRTGVDKDGAVRGHFTATGV-RPKFADRLQAFG--INLPDALYDPS 449

Query: 478 KQSRA 482
           +   A
Sbjct: 450 RHYEA 454


>gi|187919327|ref|YP_001888358.1| type II secretion system protein E [Burkholderia phytofirmans PsJN]
 gi|187717765|gb|ACD18988.1| type II secretion system protein E [Burkholderia phytofirmans PsJN]
          Length = 460

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 288/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++K  I   +I+ +++ +L +   +  R E+A L+  IV   KI M+  E+  L +D+
Sbjct: 39  YQQLKMNIHQAIIDRVELDKLQRLSPEQIRRELAQLVERIVDEDKIPMNELERRRLAQDV 98

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++++G GPL+PL+    I+DI+VN S  V++E  G+   T + F D+  L+ + +RIV+
Sbjct: 99  HDEMVGLGPLEPLLNDPTISDILVNTSQHVYVERRGRLEHTDVTFYDDAHLMKIIERIVS 158

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES+P+ DARL DGSRVN IIPP A+DGP ++IR+F  + LT+  +V+  + T 
Sbjct: 159 RVGRRIDESTPMVDARLPDGSRVNAIIPPSAIDGPLVSIRRFAVNPLTVTDMVNNQSFTP 218

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + + + NVLISGGTGSGKTTLLN L+ +I +DER+VT ED AELQ++Q HV+
Sbjct: 219 AMAQLLEALIKSKLNVLISGGTGSGKTTLLNLLSGFIPEDERVVTIEDAAELQMRQQHVL 278

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI+ R LVKN LRMRP+RI+LGEVRG E LD+L AMNTGH+GSM T+
Sbjct: 279 RLETRPPNIEGKGEISQRSLVKNALRMRPDRIVLGEVRGAEALDMLHAMNTGHEGSMATL 338

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G T+P + +R+ I S++ V+VQ  RL DG R++ +I EI G
Sbjct: 339 HANTPRDALTRLENMVGMAGLTMPIKAIRQQIASAITVVVQASRLTDGRRKLMSISEITG 398

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G DE G + G   ++GV RP+F  R A +G
Sbjct: 399 MEGDIINMQEIFTFKRTGVDENGMIKGYFCASGV-RPKFCERLAGFG 444


>gi|10956073|ref|NP_052160.1| secretory protein kinase [Chlorobium limicola]
 gi|1688242|gb|AAB36933.1| secretory protein kinase [Chlorobium limicola]
          Length = 474

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/407 (49%), Positives = 282/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y+  K  +   L+  ID+T L        R+E+   +  ++  + + +++ E+  L  DL
Sbjct: 55  YFATKMHLHQKLLTRIDLTALESLTPDRLRNELGVQLVALIEEEALPLNVQERNRLVADL 114

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N+I+G GPL+PLIA   +++IMVNG   +++E NG    T I F D+  L+ +  +IV+
Sbjct: 115 KNEIMGLGPLEPLIADPGVSEIMVNGHQNIYVEKNGCIYPTDIRFNDDAHLMKIIDKIVS 174

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DE SP+ DARL DGSRVN +IPPLAL+GP LTIR+F    L +   +    VT 
Sbjct: 175 RVGRRIDECSPMVDARLPDGSRVNAVIPPLALEGPVLTIRRFAVVPLQMRDFIQKNTVTP 234

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A LL  + +++CN++ISGGTGSGKTTLLN L+ +I   ERIVT EDTAELQLQQ HVV
Sbjct: 235 QMAELLSALVKVKCNIIISGGTGSGKTTLLNILSGFIPSSERIVTLEDTAELQLQQDHVV 294

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETR PNIEG+GEITMR LVKN LRMRP+RI++GEVR  EV+++LQAMNTGHDGS+ TI
Sbjct: 295 RMETRLPNIEGKGEITMRALVKNXLRMRPDRIVIGEVRTSEVIEMLQAMNTGHDGSLTTI 354

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN++R++ GR+E ++ M G  LPS+ + ++I SS+  IVQ  RL DGSR+IT+I EI G
Sbjct: 355 HANSSRDALGRLENLVGMSGVVLPSKALHQLIASSIHFIVQVSRLDDGSRKITSIQEISG 414

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG+VI TQ++  Y+  G +  G + G   +TG+ RP+   +   +G
Sbjct: 415 MEGDVITTQEIFCYKRTGINPDGSVQGVFSATGI-RPKAAEKIRTHG 460


>gi|186474106|ref|YP_001861448.1| type II secretion system protein E [Burkholderia phymatum STM815]
 gi|184196438|gb|ACC74402.1| type II secretion system protein E [Burkholderia phymatum STM815]
          Length = 462

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++K  +   +I+ +++ +L +   +  R E+A L+  IV   KI M+  E+  L +D+
Sbjct: 41  YQQLKMNVHEKIIDRVELDKLQRLTPEQIRRELAQLVERIVDEDKIPMNEIERRRLAQDV 100

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+PL+A   ++DI+VN S  V++E  GK   T I F D+  L+ + +RIV+
Sbjct: 101 HDEMFGLGPLEPLLADPTVSDILVNTSQHVYVERRGKLERTDITFFDDAHLMKIIERIVS 160

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES+P+ DARL DGSRVN IIPP A+DGP ++IR+F  + L ++ +V   + T 
Sbjct: 161 RVGRRIDESTPMVDARLPDGSRVNAIIPPSAIDGPLVSIRRFAVNPLKVEDMVKNQSFTP 220

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + + + NVLISGGTGSGKTTLLN L+ +I  DERIVT ED AELQL+Q HV+
Sbjct: 221 AMAQLLEALIKAKLNVLISGGTGSGKTTLLNLLSGFIPNDERIVTIEDAAELQLRQEHVL 280

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI+ R LVKN LRMRP+RI+LGEVRG E LD+L AMNTGH+GSM T+
Sbjct: 281 RLETRPPNIEGKGEISQRSLVKNALRMRPDRIVLGEVRGAEALDMLHAMNTGHEGSMATL 340

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G T+P + +R+ I S++ V+VQ  RL DG R++ +I EI G
Sbjct: 341 HANTPRDALTRLENMVGMAGLTMPIKAMRQQIASAITVVVQASRLTDGRRKLMSIQEITG 400

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I  Q++  +   G  E G + G   +TGV RP+F +R A +G
Sbjct: 401 MEGEIINMQEIFTFRRTGVAEDGTVKGYFCATGV-RPKFADRLAAFG 446


>gi|309780757|ref|ZP_07675498.1| type II/IV secretion system protein [Ralstonia sp. 5_7_47FAA]
 gi|308920439|gb|EFP66095.1| type II/IV secretion system protein [Ralstonia sp. 5_7_47FAA]
          Length = 454

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/416 (48%), Positives = 285/416 (68%), Gaps = 1/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G  +  +P Y +V   +   +I+ +++ +L Q      + E+A L+  IV   K  ++  
Sbjct: 24  GASMPASPAYQQVAMDVHQIIIDRVELGRLQQLAPDQIKRELAQLVERIVDEGKHQLNEA 83

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+ +++LGYGPL+ L+A   ++DI+VN   +V++E  GK   T + F D+  L
Sbjct: 84  ERRRLVNDVQDEMLGYGPLETLLADPTVSDILVNTYKRVYVERRGKLELTSVTFLDDAHL 143

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + V +++V++VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+D 
Sbjct: 144 MRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIDD 203

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           LV F  +T   A+L+  + + + N+LISGGTGSGKTTLLN L+ YI  DERIVT ED AE
Sbjct: 204 LVGFNTLTPAMAQLIDAMVKAKLNILISGGTGSGKTTLLNILSGYIPPDERIVTIEDAAE 263

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HV+RLETRP NIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNT
Sbjct: 264 LQLRQNHVLRLETRPANIEGRGEITQRALVKNALRMRPDRIILGEVRGAEALDMLHAMNT 323

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ TIHAN  R++  R+E MI+M G  LP + +R+ ITS+L V++Q  RL DG R+
Sbjct: 324 GHEGSLATIHANTPRDALTRLENMISMAGMQLPPRTMRQQITSALTVVLQVSRLTDGFRK 383

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + ++ EI GMEG V+  Q++  +   G D+ G++ G   +TGV RP+F  R   +G
Sbjct: 384 LMSVQEITGMEGEVVNMQEIFAFRRKGIDQHGRIRGHFCATGV-RPKFSERLKMFG 438


>gi|241662162|ref|YP_002980522.1| type II secretion system protein E [Ralstonia pickettii 12D]
 gi|240864189|gb|ACS61850.1| type II secretion system protein E [Ralstonia pickettii 12D]
          Length = 454

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/416 (48%), Positives = 285/416 (68%), Gaps = 1/416 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G  +  +P Y +V   +   +I+ +++ +L Q      + E+A L+  IV   K  ++  
Sbjct: 24  GASMPASPAYQQVAMDVHQIIIDRVELGRLQQLAPDQIKRELAQLVERIVDEGKHQLNEA 83

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+ +++LGYGPL+ L+A   ++DI+VN   +V++E  GK   T + F D+  L
Sbjct: 84  ERRRLVNDVQDEMLGYGPLETLLADPTVSDILVNTYKRVYVERRGKLELTSVTFLDDAHL 143

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           + V +++V++VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+D 
Sbjct: 144 MRVIEKMVSRVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIDD 203

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           LV F  +T   A+L+  + + + N+LISGGTGSGKTTLLN L+ YI  DERIVT ED AE
Sbjct: 204 LVGFNTLTPAMAQLIDAMVKAKLNILISGGTGSGKTTLLNILSGYIPPDERIVTIEDAAE 263

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HV+RLETRP NIEG GEIT R LVKN LRMRP+RIILGEVRG E LD+L AMNT
Sbjct: 264 LQLRQNHVLRLETRPANIEGRGEITQRALVKNALRMRPDRIILGEVRGAEALDMLHAMNT 323

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ TIHAN  R++  R+E MI+M G  LP + +R+ ITS+L V++Q  RL DG R+
Sbjct: 324 GHEGSLATIHANTPRDALTRLENMISMAGMQLPPRTMRQQITSALTVVLQVSRLTDGFRK 383

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + ++ EI GMEG V+  Q++  +   G D+ G++ G   +TGV RP+F  R   +G
Sbjct: 384 LMSVQEITGMEGEVVNMQEIFAFRRKGIDQDGRIRGHFCATGV-RPKFSERLKMFG 438


>gi|296122169|ref|YP_003629947.1| type II secretion system protein E [Planctomyces limnophilus DSM
           3776]
 gi|296014509|gb|ADG67748.1| type II secretion system protein E [Planctomyces limnophilus DSM
           3776]
          Length = 442

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/407 (48%), Positives = 281/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K  I   L+E +D+++L   +  + R EI  ++  +   +   ++  E+  L E++
Sbjct: 21  FEALKRLIHGKLVEKLDLSRLGDLEGDTLRREIRLVVEHLCDTENPLLNRSERERLIEEV 80

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G+GPL+ L+    +ADIM+NG   VFIE  G+  ++ + FRDN+ LL +  RIV+
Sbjct: 81  LDETFGFGPLEILLKEPGVADIMINGPKNVFIEKGGRIQKSEVTFRDNDHLLQILDRIVS 140

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDE+ P+ DARL DGSR+N +IPPLALDGP+LTIR+F    L L+ L+ FGA T 
Sbjct: 141 RVGRRVDETCPMVDARLPDGSRLNAVIPPLALDGPSLTIRRFGSKPLALEDLLKFGAFTP 200

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E   LL+   + R N +ISGGTGSGKTTLLN L+ +I  D+R++T ED AE+QLQQ HV+
Sbjct: 201 EMVMLLEGAMKARLNCIISGGTGSGKTTLLNTLSSFIPNDQRVITIEDAAEIQLQQEHVL 260

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG+G IT  DLVKN LRMRP+R+I+GE RG E LD+LQAMNTGH+GS+ TI
Sbjct: 261 RLETRPANIEGKGRITATDLVKNALRMRPDRVIIGECRGAEALDMLQAMNTGHEGSLTTI 320

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MIAMGG  +P + +R+   +++D+I+QT RL+ G R+IT+I E++ 
Sbjct: 321 HANTPRDAVSRLETMIAMGGVEIPLRALRQQFAAAVDLIIQTNRLQGGPRKITHITEVLN 380

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           ME + ++ QD+  +   G DETG+  G   STGV RP F +R  Q G
Sbjct: 381 MEQDTVVMQDIFVFVQDGIDETGRAFGHFESTGV-RPSFMSRLEQAG 426


>gi|149175286|ref|ZP_01853908.1| secretion system protein TadA [Planctomyces maris DSM 8797]
 gi|148845895|gb|EDL60236.1| secretion system protein TadA [Planctomyces maris DSM 8797]
          Length = 461

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 281/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + ++K  I   L+E +D++++   +  S R EI  ++  +   +   ++  E+  L E++
Sbjct: 41  FDDLKRLIHGKLVEKLDLSRVGDLEGDSLRREIRLVIEHLCDTENPLLNRSERERLIEEI 100

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G+GPL+ L+   DIADIM+NG   VF+E NG+   + + FRDN+ LL +  RIV+
Sbjct: 101 LDETFGFGPLELLLKDQDIADIMINGPKHVFVEKNGRIERSSVVFRDNQHLLQILDRIVS 160

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDE+SP+ DARL DGSR+N +IPPLALDGP+LTIRKF  + L L+ L+ FGA T 
Sbjct: 161 KVGRRVDETSPLVDARLPDGSRLNAVIPPLALDGPSLTIRKFGSNPLGLEDLLRFGAFTP 220

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A LL+   + R N +ISGGTGSGKTTLLN L+ +I  D R++T ED AELQLQQ H++
Sbjct: 221 EIAMLLEGAIKARINTIISGGTGSGKTTLLNTLSGFIQSDHRVITIEDAAELQLQQEHIL 280

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG G I+  DLVKN LRMRP+RII+GE RG E LD+LQAMNTGH+GS+ TI
Sbjct: 281 RLETRPPNIEGRGAISATDLVKNALRMRPDRIIIGECRGGESLDMLQAMNTGHEGSLTTI 340

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E MI MGG  LP + +R+   S++D+I+Q  RL+ G R++T++ E++ 
Sbjct: 341 HANSPRDAVSRLETMITMGGVELPLKALRQQFASAVDLIIQVNRLQGGPRKVTHVTEVLN 400

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           ME + +I QD+  +   G D  G+  G   +TGV RP F +R    G
Sbjct: 401 MEQDTVIMQDIFLFVQDGIDADGRAYGHFEATGV-RPAFMDRLEAAG 446


>gi|288956972|ref|YP_003447313.1| pilus assembly protein [Azospirillum sp. B510]
 gi|288909280|dbj|BAI70769.1| pilus assembly protein [Azospirillum sp. B510]
          Length = 459

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 287/427 (67%), Gaps = 5/427 (1%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G   +R P    ++  +F+     I+++ +     +  +D++  ++  I + +++ ++  
Sbjct: 37  GMVADRHPMELLIREKLFSR----INVSAVVTTGRERLQDDMVQIVAAITAAERLPINAA 92

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           EQ  +   + +D+ G GPL+PL+A + + DIMVNG ++V++E +GK   T   FRD+   
Sbjct: 93  EQEQIVTRVLDDMFGLGPLEPLLADETVTDIMVNGPHQVYVERHGKLELTDCRFRDDAHA 152

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
            +V QRI   +GRRVDESSP  DARL DGSRVN+++PP+AL+G  ++IRKF K K+    
Sbjct: 153 TNVAQRIAASIGRRVDESSPTVDARLADGSRVNIVLPPVALNGCVISIRKFAKRKVDFAQ 212

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           +V    ++A  ++LL+I    R N++ISGGTGSGKTTLLN L+R ID  ER++T ED AE
Sbjct: 213 MVRQENLSAGMSKLLEIAAACRLNIVISGGTGSGKTTLLNALSRMIDPRERVLTIEDAAE 272

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQLQQPHVV LETRP N+EG GEI  RDLVKN LRMRP+RIILGE RG E  D+LQAMNT
Sbjct: 273 LQLQQPHVVSLETRPVNVEGHGEINQRDLVKNALRMRPDRIILGETRGSEAFDVLQAMNT 332

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GHDGSM T+HAN  R++  R+E M+ M    LP + +R  I S+++++VQ +R+RDG RR
Sbjct: 333 GHDGSMTTVHANTPRDALVRLENMVLMSNANLPIRAIRMQIASAVNLVVQIERMRDGVRR 392

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
           + +I E++GMEG++I TQDL  +E        K+IG  +STGV RP F  RAA YG E+ 
Sbjct: 393 LQSITEVIGMEGDIITTQDLYVFEYDAASFGDKVIGSFVSTGV-RPHFSRRAAYYGLEEA 451

Query: 469 LAEVLQS 475
           L   +++
Sbjct: 452 LMAAMKT 458


>gi|157961840|ref|YP_001501874.1| type II secretion system protein E [Shewanella pealeana ATCC
           700345]
 gi|157846840|gb|ABV87339.1| type II secretion system protein E [Shewanella pealeana ATCC
           700345]
          Length = 442

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/419 (48%), Positives = 290/419 (69%), Gaps = 1/419 (0%)

Query: 48  IGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSL 107
           I +F   T    ++K  ++  L+ ++D++ +     + AR +I+ +  +I++   + ++L
Sbjct: 10  IQDFQPLTQDEQDIKVALYDKLLSVMDLSLIETVSKEQARIQISEICEQILNGLNLPINL 69

Query: 108 DEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQ 167
             +  L   + +++LG GPL+ L+A   I+DI+VN  ++V++E  GK     I F  N  
Sbjct: 70  STRKRLVGLIIDEVLGLGPLETLLADPSISDILVNSYDRVYVERKGKLEAVNIKFHSNSH 129

Query: 168 LLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLD 227
           LL++  RIV+ VGRR+DESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F  DKL   
Sbjct: 130 LLNIIDRIVSSVGRRIDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFAVDKLNAG 189

Query: 228 HLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA 287
            L+  G+VT     LL+   + + N+L+SGGTGSGKTTLLN L+ +I  DERIVT ED+A
Sbjct: 190 QLIEIGSVTEAMIELLKGGVKGKLNILVSGGTGSGKTTLLNMLSGFIPSDERIVTIEDSA 249

Query: 288 ELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMN 347
           ELQLQQPH VRLETRP NIEG+GE++ RDLVKNCLRMRP+RI++GEVRG E LD+L AMN
Sbjct: 250 ELQLQQPHTVRLETRPQNIEGKGEVSQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMN 309

Query: 348 TGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSR 407
           TGH+GS+ T+HAN+ R++ GR+E M+ M GF +P   +R  + S++D++VQ +R  DG R
Sbjct: 310 TGHEGSLTTLHANSPRDALGRLEYMVCMAGFDMPVSNIRTQVASAIDMVVQLERQEDGRR 369

Query: 408 RITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           R+T+I EI GMEG++I   ++ ++   G DE G +IG+  +TGV  P F  +  Q+G E
Sbjct: 370 RLTSIQEINGMEGDIITMSEIFRFTRKGLDEEGMIIGEFEATGVI-PSFHAKLKQHGIE 427


>gi|84386794|ref|ZP_00989819.1| component of type IV pilus [Vibrio splendidus 12B01]
 gi|84378322|gb|EAP95180.1| component of type IV pilus [Vibrio splendidus 12B01]
          Length = 447

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 211/433 (48%), Positives = 289/433 (66%), Gaps = 4/433 (0%)

Query: 35  QNLQSSSP--SAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT 92
           QN Q+  P  +        ++ TP   E    I   +I+ ID + +    +      I  
Sbjct: 4   QNTQAIDPIVTNRARSHEALSSTPSVREHYHVIHEEVIKAIDPSVVVSLSAPDLEARITE 63

Query: 93  LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVN 152
           +++ IV  K++ +   +     E L N+ LG GPLQPLI    I DIMVNG  +V++E +
Sbjct: 64  MVSNIVVSKQLPLGHKDVAHSVEQLLNEFLGLGPLQPLIEDQGITDIMVNGYREVYVERS 123

Query: 153 GKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGP 212
           GK  +T + FR+ EQLL++ +RIV++VGRR+DES+P+ DARL DGSRVNV+IPPLALDG 
Sbjct: 124 GKLQKTPVQFRNEEQLLNLARRIVSKVGRRIDESNPLVDARLDDGSRVNVMIPPLALDGT 183

Query: 213 TLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTR 272
            ++IRKF ++KLTL  L  FGA++    +L+ II R R NVL++GGTG+GKTTLLN ++ 
Sbjct: 184 YISIRKFNENKLTLSQLAQFGAMSKSMVKLIDIIVRSRLNVLVAGGTGAGKTTLLNAMSF 243

Query: 273 YIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILG 332
            I   ERI+T EDTAEL+LQQPHVVR ETRP N EG   IT R+LV+N LRMRP+RIILG
Sbjct: 244 SISPQERIITIEDTAELRLQQPHVVRAETRPANAEGLTPITQRELVRNALRMRPDRIILG 303

Query: 333 EVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSS 392
           EVRG E  +++QAMNTGHDGS+ T+HAN+A ++  RME M+ M   TLP   +R  I  +
Sbjct: 304 EVRGDEAFEMMQAMNTGHDGSLCTLHANSATDALVRMENMLMMSQATLPLFSLRRQIADT 363

Query: 393 LDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
           +DV++Q +R+RDG RRI +I E+ G+EG   ITQDL K++ + ED+ G LIG++ S    
Sbjct: 364 IDVVIQVERMRDGKRRILSITEVQGLEGEQYITQDLFKFKPLSEDQQGNLIGEYKSAKCV 423

Query: 453 RPRFWNRAAQYGE 465
            P F N  A+Y +
Sbjct: 424 -PSF-NEKAKYHQ 434


>gi|254441363|ref|ZP_05054856.1| Type II/IV secretion system protein [Octadecabacter antarcticus
           307]
 gi|198251441|gb|EDY75756.1| Type II/IV secretion system protein [Octadecabacter antarcticus
           307]
          Length = 482

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/381 (51%), Positives = 272/381 (71%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  + EI++++ E +    + ++ DE+  L +DL  ++ G GPL+ L+  + + DI+VNG
Sbjct: 89  QDLKAEISSIVQESLDELGVILNRDERQTLNKDLFFEVKGLGPLETLLQDESVNDILVNG 148

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++F+E +GK   T + F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 149 PQQIFVERDGKLQLTDVTFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAM 208

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R N+++SGGTGSGK
Sbjct: 209 VPPIAVDGSLVSIRKFKKDKLGIDDLVKFGAFTEEMAAYLQAAVSTRLNIIVSGGTGSGK 268

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID DERI+T EDTAELQLQQ HV R+E+RPPN+EG+G ++ RD ++N LR
Sbjct: 269 TTSLNALSSFIDDDERILTIEDTAELQLQQTHVGRMESRPPNVEGKGGVSQRDCLRNALR 328

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 329 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLK 388

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
             R  I+S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ KY+ +G     K+I
Sbjct: 389 ATRSQISSAVNLIVQVSRLQDGSRRMVSITEITGMEGDVISMQEVFKYQRVGLTPDNKII 448

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G   +TGV R  F  R   +G
Sbjct: 449 GHFTATGV-RSHFSERFKLWG 468


>gi|254255259|ref|ZP_04948575.1| Flp pilus assembly protein ATPase CpaF [Burkholderia dolosa AUO158]
 gi|124900996|gb|EAY71746.1| Flp pilus assembly protein ATPase CpaF [Burkholderia dolosa AUO158]
          Length = 463

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/437 (46%), Positives = 298/437 (68%), Gaps = 4/437 (0%)

Query: 33  QKQNLQSSSPS-AEGEIGNFVNRTPH--YYEVKSTIFTTLIEMIDITQLSQYDSQSARDE 89
           ++ +L  + PS A GE     + +    Y +++  I  T+++ +++ +LS+   +  R E
Sbjct: 13  EQMSLHRAQPSGANGEPAGPAHSSVRDAYQKLRRQIHLTVLDRVELERLSRLPQEQVRHE 72

Query: 90  IATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFI 149
           I  L+  I+  +++  +  E+  L  D+ +++ G+GPL  L+    I+DI+VN   +V++
Sbjct: 73  ITALITRILDDERLPANDIERRQLAIDVYDEMFGFGPLDALLRDPTISDILVNTYRQVYV 132

Query: 150 EVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLAL 209
           E  G+   T + F D+  L+ V ++IV++VGRR+DESSP+ DARL DGSRVN IIPP A+
Sbjct: 133 ERCGRLELTDVTFYDDAHLMKVIEKIVSRVGRRIDESSPMVDARLPDGSRVNAIIPPSAI 192

Query: 210 DGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNC 269
           DGP ++IR+F  + L ++ LV F +VT   A LL  + R + NVL+SGGTGSGKTTLLN 
Sbjct: 193 DGPLMSIRRFAINPLKMEDLVRFQSVTPPMATLLDALSRAKVNVLVSGGTGSGKTTLLNI 252

Query: 270 LTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERI 329
           L+ +I + ERIVT ED AELQLQQPHV+RLETRPPNIEG+GEIT R LV+N LRMRP+RI
Sbjct: 253 LSGFIPRSERIVTIEDAAELQLQQPHVLRLETRPPNIEGKGEITQRTLVRNALRMRPDRI 312

Query: 330 ILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREII 389
           ILGEVRG E LD+L AMNTGH+GS+ TIHAN  R++  R+E MI++ G +LP + +R+ I
Sbjct: 313 ILGEVRGAEALDMLNAMNTGHEGSLATIHANTPRDALTRLENMISIAGLSLPPKTMRQQI 372

Query: 390 TSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIST 449
            S++ V+VQ  RL DG+R+I +I E+ GMEG++I  Q++  ++  G D  G + G   +T
Sbjct: 373 ASAISVVVQAARLTDGTRKIVSIQELTGMEGDIINMQEIFTFKRTGVDRDGTVRGHFCAT 432

Query: 450 GVSRPRFWNRAAQYGEE 466
           GV RP+F  R   +G E
Sbjct: 433 GV-RPKFVERLQAFGIE 448


>gi|86159247|ref|YP_466032.1| type II secretion system protein E [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775758|gb|ABC82595.1| type II secretion system protein E [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 450

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 281/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           ++++K  +   +++ +D+    +   +  +DE+  ++   ++ +++ ++  E+  + ++L
Sbjct: 29  FHDLKGELHRRIVDALDLQAFEKLAPERRQDELRNVLAGEIARRELPLNQIERERMVQEL 88

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+PL+A   I+DI+VN    V+IE  G+   T + F DN+ L+ +  RIV+
Sbjct: 89  LDELTGLGPLEPLLADPTISDILVNTYATVYIERGGRLELTPVRFADNQHLMQIINRIVS 148

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRRVDE+SP+ DARL DGSRVN IIPPLALDGP ++IR+F    L +  L++ GA++ 
Sbjct: 149 RIGRRVDETSPMVDARLPDGSRVNAIIPPLALDGPIVSIRRFGVTPLRMRDLLAGGALST 208

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    L      + N+LISGGTG+GKTTLLN L+ +I  D+RIVT ED+AELQLQQ HVV
Sbjct: 209 EAGGFLGACVEAKLNILISGGTGAGKTTLLNALSAFIPDDQRIVTIEDSAELQLQQRHVV 268

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI  RDLVKN LRMRP+RI++GEVRG EVLD+LQAMNTGH+GSM T+
Sbjct: 269 RLETRPPNIEGKGEILARDLVKNALRMRPDRIVVGEVRGGEVLDMLQAMNTGHEGSMTTV 328

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAMI M G  L     R  I+  L+VIVQ  R  DG RRIT+I EI G
Sbjct: 329 HANTPRDALARLEAMIGMSGVPLSEGATRATISRGLNVIVQLNRGTDGRRRITSIAEITG 388

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            EG  I  QD+ ++E  G D TGK++G+   TG+ RPR   R AQ+G
Sbjct: 389 TEGAAITMQDVFRFEQHGVDATGKILGEFRPTGI-RPRALTRIAQFG 434


>gi|209515954|ref|ZP_03264815.1| type II secretion system protein E [Burkholderia sp. H160]
 gi|209503612|gb|EEA03607.1| type II secretion system protein E [Burkholderia sp. H160]
          Length = 460

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/423 (47%), Positives = 283/423 (66%), Gaps = 5/423 (1%)

Query: 52  VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
           V R+ ++ ++++ +F ++    +++          R  I  +  + V+ +++ ++  EQ 
Sbjct: 42  VIRSDNFKKIRAVVFASM----NMSAALMKTRDQVRAGIEEIAADAVAREQLHITPSEQA 97

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            +  ++ ND+ G GP++PL+A D + DI+VNG ++V+ E +G+   T + FRDN  + +V
Sbjct: 98  QIVGEILNDMFGVGPIEPLLADDAVTDILVNGPDQVYAERHGRLELTPLKFRDNAHVTNV 157

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            QRI   VGRRVDESSP+ DARL DGSRVNV++PP+AL G +++IRKF +  +T   +  
Sbjct: 158 AQRIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIALRGASISIRKFSRRNITFARMAQ 217

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
            G ++ E  R+L+I G  R N++ISGGTGSGKTTLLN L+ +ID+ ER+VT ED AELQL
Sbjct: 218 QGNMSPEMVRVLKIAGACRLNIIISGGTGSGKTTLLNALSHHIDEHERVVTIEDAAELQL 277

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVV LETRP N EG G +T RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHD
Sbjct: 278 QQPHVVSLETRPENSEGLGAVTQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHD 337

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T 
Sbjct: 338 GSMTTIHANTPRDAITRLESMVMMANGNLPLTAIRRQIASAVHLILQIERMRDGVRRVTR 397

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
           + E+ GMEG+VIITQDL  +          + G   S+ + RP F  RAA YG E  L E
Sbjct: 398 VTELAGMEGDVIITQDLFAFRYDASAYQEDVKGTFESSSL-RPVFATRAAYYGLETALME 456

Query: 472 VLQ 474
            L+
Sbjct: 457 ALR 459


>gi|254487404|ref|ZP_05100609.1| type II secretion system protein E [Roseobacter sp. GAI101]
 gi|214044273|gb|EEB84911.1| type II secretion system protein E [Roseobacter sp. GAI101]
          Length = 507

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/419 (47%), Positives = 282/419 (67%), Gaps = 1/419 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P    + + +  +L+E +D ++L+          I + +  + + KK+ M+  E  +L 
Sbjct: 88  SPKMLALANDVVRSLLEFMDFSELAAKPRAEQEKLIRSGIEIVSTEKKMHMNGREIQELV 147

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           E +  D+LG GPL+ L+  + I DIMVNG +++++E  GK   T + FRDN  + SV  R
Sbjct: 148 ETVLADMLGLGPLEQLLNDERITDIMVNGPDQIYVERGGKLELTQVRFRDNAHVFSVASR 207

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           I + VGRR+DES P+ DARL DGSRVN+ +PPLA+DGPT+TIRKF    + L  LV  G+
Sbjct: 208 IASAVGRRIDESQPMVDARLADGSRVNIAVPPLAIDGPTITIRKFPSAPVMLQSLVDGGS 267

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           ++ + +R L +   +R N+L+SGGTGSGKTTL+N ++ +I + ERIVT ED AEL+ QQ 
Sbjct: 268 LSLQMSRFLGLAAYLRLNILVSGGTGSGKTTLMNAMSAFIPEGERIVTIEDAAELRFQQG 327

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVR ETRPPN+EG GE+TMR LV+N LRMRP+RII+GE+RG EVLDLLQAMNTGHDGSM
Sbjct: 328 HVVRFETRPPNVEGMGEVTMRTLVRNALRMRPDRIIIGEIRGDEVLDLLQAMNTGHDGSM 387

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T+HAN+  E+  R+E+M A+ GF     +VR  +  ++ +IVQ  R+RDG RR+T+I E
Sbjct: 388 STLHANSPTEALTRVESMAALAGFAPGGGVVRRQLVDAVHLIVQVSRMRDGKRRVTSISE 447

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           I G+ G+VI  Q+L  ++        ++ G+H+ +G  RP+F +RAA YG    L  +L
Sbjct: 448 IAGLAGDVITLQELFSFQPDENSTRAQVTGKHVYSGY-RPKFASRAADYGVADELDAIL 505


>gi|167581958|ref|ZP_02374832.1| component of type IV pilus [Burkholderia thailandensis TXDOH]
          Length = 458

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 278/415 (66%), Gaps = 1/415 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   TI T +   ++++          R+ I     ++++ +++T++L EQ  + E++ N
Sbjct: 44  ETFKTIRTVVFSSMNMSAALMMSRAEVREGIEQTAADVIARERLTVTLAEQALIVEEILN 103

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRDN  +++V QRI   V
Sbjct: 104 DMFGVGPIEPLLADERVTDILVNGPDQVYVERAGRLELTPLKFRDNAHVINVAQRIAAAV 163

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++   
Sbjct: 164 GRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNLSQAM 223

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQPHVV L
Sbjct: 224 VEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQPHVVSL 283

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGSM TIHA
Sbjct: 284 ETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGSMTTIHA 343

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + EI GME
Sbjct: 344 NTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVTEIAGME 403

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   LQ
Sbjct: 404 GDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGALQ 457


>gi|167624199|ref|YP_001674493.1| type II secretion system protein E [Shewanella halifaxensis
           HAW-EB4]
 gi|167354221|gb|ABZ76834.1| type II secretion system protein E [Shewanella halifaxensis
           HAW-EB4]
          Length = 442

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/419 (48%), Positives = 289/419 (68%), Gaps = 1/419 (0%)

Query: 48  IGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSL 107
           I +F   T    ++K T++  L+ M+D++ +       A+ +I+ +  +I++   + ++L
Sbjct: 10  INDFQPLTQDEQDIKVTLYDKLLSMMDLSLIETVSKDQAQVQISEICEQILNGLNLPINL 69

Query: 108 DEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQ 167
             +  L   + +++LG GPL+ L++   I+DI+VN  ++V+IE  GK     I F  N  
Sbjct: 70  STRKRLIGLIIDEVLGLGPLETLLSDPSISDILVNSYDRVYIERKGKLEAVNIKFHSNAH 129

Query: 168 LLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLD 227
           LL++  RIV+ VGRR+DESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F  DKL   
Sbjct: 130 LLNIIDRIVSSVGRRIDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFAVDKLNAR 189

Query: 228 HLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA 287
            L+  G+VT     LL+   + + N+L+SGGTGSGKTTLLN L+ +I  DERIVT ED+A
Sbjct: 190 QLIDIGSVTESMIELLKGSVKGKLNILVSGGTGSGKTTLLNMLSGFIPSDERIVTIEDSA 249

Query: 288 ELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMN 347
           ELQLQQPH VRLETRP NIEG+GE++ RDLVKNCLRMRP+RI++GEVRG E LD+L AMN
Sbjct: 250 ELQLQQPHTVRLETRPQNIEGKGEVSQRDLVKNCLRMRPDRIVIGEVRGGEALDMLTAMN 309

Query: 348 TGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSR 407
           TGH+GS+ T+HAN+ R++ GR+E M+ M GF +P   +R  I S++D++VQ +R  DG R
Sbjct: 310 TGHEGSLTTLHANSPRDALGRLEYMVCMAGFDMPVSNIRTQIASAIDLVVQLERQEDGRR 369

Query: 408 RITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           R+T+I EI GMEG++I   ++ ++   G +E G +IG   +TGV  P F  +  Q+G E
Sbjct: 370 RVTSIQEINGMEGDIITMSEIFRFSRKGINEEGMIIGDFEATGVI-PGFHAKLKQHGIE 427


>gi|87312290|ref|ZP_01094388.1| secretion system protein TadA [Blastopirellula marina DSM 3645]
 gi|87284994|gb|EAQ76930.1| secretion system protein TadA [Blastopirellula marina DSM 3645]
          Length = 441

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 288/422 (68%), Gaps = 1/422 (0%)

Query: 43  SAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKK 102
           S   E  N   +   +  +K  I   L++ +D++++ + + +  R EI  ++  +   ++
Sbjct: 5   SLNSEAKNGDAKQAEFENLKRRIHGKLVDKLDLSKVGELEGEVLRREIRLVVEHLCDTEE 64

Query: 103 ITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINF 162
             ++ +E+  L E++ ++  G GPL+ L+    I+DI++NG  +++ E NG+  ++ + F
Sbjct: 65  TLLNRNERERLIEEVLDETFGLGPLELLLKDHAISDILINGPKQIYCEKNGRLEKSPVTF 124

Query: 163 RDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKD 222
           RDN  LL +  RIV++VGRRVDE+ P+ DARL DGSR N IIPPLALDG  ++IR+F  +
Sbjct: 125 RDNNHLLQIIDRIVSRVGRRVDETCPMVDARLPDGSRFNAIIPPLALDGAAVSIRRFGSN 184

Query: 223 KLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVT 282
            L L+ L+++ A T E   LL+   + R N++ISGGTGSGKTTLLN L+ +I   ERIVT
Sbjct: 185 PLKLEDLLNYKAFTPEMVMLLEGAIKARLNIIISGGTGSGKTTLLNTLSSFISASERIVT 244

Query: 283 CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDL 342
            ED AELQLQQ HVVRLETRP N+EG+G +T  DLV+N LRMRPERII+GE RG E LD+
Sbjct: 245 IEDAAELQLQQDHVVRLETRPSNVEGKGSVTATDLVRNALRMRPERIIIGECRGGETLDM 304

Query: 343 LQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRL 402
           LQAMNTGH+GSM TIHAN  R++  R+E +I+M GF LP + +R+ I S++D+I+Q  R+
Sbjct: 305 LQAMNTGHEGSMTTIHANTPRDAIARVETLISMAGFDLPIKAMRQQIASAVDLIIQANRM 364

Query: 403 RDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQ 462
           + GSRR+T+I E++GME + ++ QD+ KY   G DETG+  GQ  +TGV RP F +R   
Sbjct: 365 QGGSRRVTHITEVIGMEQDTVVMQDVYKYNKTGIDETGRARGQFEATGV-RPNFMSRLES 423

Query: 463 YG 464
            G
Sbjct: 424 AG 425


>gi|126438606|ref|YP_001058911.1| type IV pilus assembly protein [Burkholderia pseudomallei 668]
 gi|126218099|gb|ABN81605.1| type IV pilus assembly protein [Burkholderia pseudomallei 668]
          Length = 523

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 278/415 (66%), Gaps = 1/415 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   TI T +   ++++          R+ I     ++++ +++T++L EQ  + +++ N
Sbjct: 109 ETFKTIRTVVFSSMNMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALIVDEILN 168

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V QRI   V
Sbjct: 169 DMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQRIAAAV 228

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++   
Sbjct: 229 GRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNLSQAM 288

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQPHVV L
Sbjct: 289 VEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQPHVVSL 348

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGSM TIHA
Sbjct: 349 ETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGSMTTIHA 408

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + EI GME
Sbjct: 409 NTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVTEIAGME 468

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   LQ
Sbjct: 469 GDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGALQ 522


>gi|254258616|ref|ZP_04949670.1| type IV pilus assembly protein [Burkholderia pseudomallei 1710a]
 gi|254217305|gb|EET06689.1| type IV pilus assembly protein [Burkholderia pseudomallei 1710a]
          Length = 493

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 77  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 132

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 133 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 192

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 193 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 252

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 253 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 312

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 313 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 372

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 373 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 432

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 433 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 491

Query: 474 Q 474
           Q
Sbjct: 492 Q 492


>gi|257139201|ref|ZP_05587463.1| component of type IV pilus [Burkholderia thailandensis E264]
          Length = 528

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 278/415 (66%), Gaps = 1/415 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   TI T +   ++++          R+ I     ++++ +++T++L EQ  + E++ N
Sbjct: 114 ETFKTIRTVVFSSMNMSAALMMSRAEVREGIEQTAADVIARERLTVTLAEQALIVEEILN 173

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRDN  +++V QRI   V
Sbjct: 174 DMFGVGPIEPLLADERVTDILVNGPDQVYVERAGRLELTPLKFRDNAHVINVAQRIAAAV 233

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++   
Sbjct: 234 GRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNLSQAM 293

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQPHVV L
Sbjct: 294 VEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQPHVVSL 353

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGSM TIHA
Sbjct: 354 ETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGSMTTIHA 413

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + EI GME
Sbjct: 414 NTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVTEIAGME 473

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   LQ
Sbjct: 474 GDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGALQ 527


>gi|296156492|ref|ZP_06839330.1| type II secretion system protein E [Burkholderia sp. Ch1-1]
 gi|295893091|gb|EFG72871.1| type II secretion system protein E [Burkholderia sp. Ch1-1]
          Length = 459

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/407 (48%), Positives = 288/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++K  I   +I+ +++ +L +   +  R E+A L+  IV   KI M+  E+  L +D+
Sbjct: 38  YQQLKMNIHQAIIDRVELDKLQRLSPEQIRRELAQLVERIVDEDKIPMNELERRRLAQDV 97

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++++G GPL+PL+    I+DI+VN S  V++E  G+   T + F D+  L+ + +RIV+
Sbjct: 98  HDEMVGLGPLEPLLNDPTISDILVNTSQHVYVERRGRLEHTDVTFYDDAHLMKIIERIVS 157

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES+P+ DARL DGSRVN IIPP A+DGP ++IR+F  + LT+  +V+  + T 
Sbjct: 158 RVGRRIDESTPMVDARLPDGSRVNAIIPPSAIDGPLVSIRRFAVNPLTVTDMVNNQSFTP 217

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A+LL+ + + + NVLISGGTGSGKTTLLN L+ +I +DER+VT ED AELQ++Q HV+
Sbjct: 218 AMAQLLEALIKAKLNVLISGGTGSGKTTLLNLLSGFIPEDERVVTIEDAAELQMRQQHVL 277

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI+ R LV+N LRMRP+RI+LGEVRG E LD+L AMNTGH+GSM T+
Sbjct: 278 RLETRPPNIEGKGEISQRSLVRNALRMRPDRIVLGEVRGAEALDMLHAMNTGHEGSMATL 337

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G T+P + +R+ I S++ V+VQ  RL DG R++ +I E+ G
Sbjct: 338 HANTPRDALTRLENMVGMAGLTMPIKAIRQQIASAITVVVQASRLTDGRRKLMSIQEVTG 397

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G DE G + G   + GV RP+F +R A +G
Sbjct: 398 MEGDIINMQEIFTFKRTGVDENGLIKGYFCAIGV-RPKFCDRLAGFG 443


>gi|156741663|ref|YP_001431792.1| type II secretion system protein E [Roseiflexus castenholzii DSM
           13941]
 gi|156232991|gb|ABU57774.1| type II secretion system protein E [Roseiflexus castenholzii DSM
           13941]
          Length = 465

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/410 (49%), Positives = 287/410 (70%), Gaps = 6/410 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E++  +   LI  +D  +L   +    R ++  + N I+  + I +S  E+  LFE +  
Sbjct: 47  ELRQRVQQRLINELD-PRLDLSNVARVRQQVEEIFNTILDSENIVLSRSERARLFESIAA 105

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           DILG+GPLQ L+   +I++IMVNG  KV++E  GK   + + F D + +L V  RIV  +
Sbjct: 106 DILGFGPLQELLNDPEISEIMVNGPRKVYVEKRGKIQLSDVTFVDEQHVLRVIDRIVAPL 165

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVN +I P+AL GPT++IRKF+K+ +T++ L+ FG++T E 
Sbjct: 166 GRRIDESSPMVDARLPDGSRVNAVIRPIALCGPTISIRKFRKEGITIEDLIRFGSLTREM 225

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  L    R   N+++SGGTGSGKTT+LN L+ +I  DERI+T E+ AELQL+Q HVV L
Sbjct: 226 AEFLSACVRASLNIVVSGGTGSGKTTMLNVLSSFIPDDERIITVENAAELQLRQEHVVPL 285

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GEI++RDLV N LRMRPERI++GE RG E L++LQAMNTGHDGSM T+HA
Sbjct: 286 ESRPPNVEGKGEISIRDLVINTLRMRPERIVVGECRGGEALEMLQAMNTGHDGSMTTLHA 345

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ R++  R+E M  M G  LP + +RE I S++++IVQ  RL+DGSR++  I E+ GME
Sbjct: 346 NSPRDAIARIETMCLMAGMDLPVRAIREQIASAVNLIVQLARLKDGSRKVIYITEVQGME 405

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNL 469
           G+V++  D+  +E  G DE GK+IGQ   TG+ RPRF +R     EE+N+
Sbjct: 406 GDVVVLSDIFVFEQQGIDERGKIIGQLKPTGI-RPRFIDRF----EERNI 450


>gi|167738671|ref|ZP_02411445.1| type IV pilus assembly protein [Burkholderia pseudomallei 14]
 gi|167815893|ref|ZP_02447573.1| type IV pilus assembly protein [Burkholderia pseudomallei 91]
          Length = 465

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 49  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 104

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 105 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 164

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 165 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 224

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 225 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 284

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 285 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 344

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 345 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 404

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 405 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 463

Query: 474 Q 474
           Q
Sbjct: 464 Q 464


>gi|167845812|ref|ZP_02471320.1| component of type IV pilus [Burkholderia pseudomallei B7210]
          Length = 475

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 59  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 114

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 115 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 174

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 175 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 234

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 235 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 294

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 295 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 354

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 355 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 414

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 415 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 473

Query: 474 Q 474
           Q
Sbjct: 474 Q 474


>gi|53719428|ref|YP_108414.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
 gi|52209842|emb|CAH35814.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei K96243]
          Length = 524

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 108 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 163

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 164 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 223

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 224 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 283

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 284 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 343

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 344 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 403

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 404 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 463

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 464 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 522

Query: 474 Q 474
           Q
Sbjct: 523 Q 523


>gi|83719018|ref|YP_442977.1| component of type IV pilus [Burkholderia thailandensis E264]
 gi|83652843|gb|ABC36906.1| component of type IV pilus [Burkholderia thailandensis E264]
          Length = 515

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 278/415 (66%), Gaps = 1/415 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   TI T +   ++++          R+ I     ++++ +++T++L EQ  + E++ N
Sbjct: 101 ETFKTIRTVVFSSMNMSAALMMSRAEVREGIEQTAADVIARERLTVTLAEQALIVEEILN 160

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRDN  +++V QRI   V
Sbjct: 161 DMFGVGPIEPLLADERVTDILVNGPDQVYVERAGRLELTPLKFRDNAHVINVAQRIAAAV 220

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++   
Sbjct: 221 GRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNLSQAM 280

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQPHVV L
Sbjct: 281 VEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQPHVVSL 340

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGSM TIHA
Sbjct: 341 ETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGSMTTIHA 400

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + EI GME
Sbjct: 401 NTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVTEIAGME 460

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   LQ
Sbjct: 461 GDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGALQ 514


>gi|197123315|ref|YP_002135266.1| type II secretion system protein E [Anaeromyxobacter sp. K]
 gi|196173164|gb|ACG74137.1| type II secretion system protein E [Anaeromyxobacter sp. K]
          Length = 452

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 279/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           ++++K  +   +++ +D+    +   +  R+E+  ++   ++ + + ++  E+  + ++L
Sbjct: 29  FHDLKGELHRRIVDALDLQAFEKLAPERRREELRNVLAAEIARRDLPLNQIERERMVQEL 88

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+PL+A   I+DI+VN    V+IE  G+   T + F DN+ L+ +  RIV+
Sbjct: 89  LDELTGLGPLEPLLADPTISDILVNTYATVYIERAGRLELTPVRFADNQHLMQIINRIVS 148

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRRVDE+SP+ DARL DGSRVN IIPPLALDGP ++IR+F    L +  L++ GA++A
Sbjct: 149 RIGRRVDETSPMVDARLPDGSRVNAIIPPLALDGPIVSIRRFGVTPLRMRDLLAGGALSA 208

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A  L      + N+LISGGTG+GKTTLLN L+ +I   +RIVT ED+AELQLQQ HVV
Sbjct: 209 EAAGFLGACVEAKLNILISGGTGAGKTTLLNALSAFIPDSQRIVTIEDSAELQLQQRHVV 268

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEI  RDLVKN LRMRP+RI++GEVRG EVLD+LQAMNTGH+GSM T+
Sbjct: 269 RLETRPPNIEGKGEIIARDLVKNALRMRPDRIVVGEVRGGEVLDMLQAMNTGHEGSMTTV 328

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAMI M G  L     R  I+  L+VIVQ  R  DG RRIT+I EI G
Sbjct: 329 HANTPRDALARLEAMIGMSGVPLSEGATRATISRGLNVIVQLNRGTDGRRRITSIAEITG 388

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            EG  I  QD+ ++E  G D TGK+ G    TG+ RPR   R AQ+G
Sbjct: 389 TEGAAITMQDVFRFEQHGVDPTGKIQGDFRPTGI-RPRALTRIAQFG 434


>gi|254177576|ref|ZP_04884231.1| CpaF [Burkholderia mallei ATCC 10399]
 gi|160698615|gb|EDP88585.1| CpaF [Burkholderia mallei ATCC 10399]
          Length = 521

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 105 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 160

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 161 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 220

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 221 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 280

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 281 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 340

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 341 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 400

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 401 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 460

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 461 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 519

Query: 474 Q 474
           Q
Sbjct: 520 Q 520


>gi|167919046|ref|ZP_02506137.1| type IV pilus assembly protein [Burkholderia pseudomallei BCC215]
          Length = 469

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 53  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 108

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 109 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 168

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 169 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 228

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 229 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 288

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 289 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 348

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 349 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 408

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 409 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 467

Query: 474 Q 474
           Q
Sbjct: 468 Q 468


>gi|167894384|ref|ZP_02481786.1| type IV pilus assembly protein [Burkholderia pseudomallei 7894]
          Length = 473

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 57  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 112

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 113 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 172

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 173 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 232

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 233 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 292

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 293 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 352

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 353 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 412

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 413 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 471

Query: 474 Q 474
           Q
Sbjct: 472 Q 472


>gi|167719680|ref|ZP_02402916.1| type IV pilus assembly protein [Burkholderia pseudomallei DM98]
          Length = 460

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 44  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 99

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 100 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 159

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 160 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 219

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 220 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 279

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 280 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 339

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 340 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 399

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 400 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 458

Query: 474 Q 474
           Q
Sbjct: 459 Q 459


>gi|237812168|ref|YP_002896619.1| CpaF [Burkholderia pseudomallei MSHR346]
 gi|237505006|gb|ACQ97324.1| CpaF [Burkholderia pseudomallei MSHR346]
          Length = 536

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 120 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 175

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 176 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 235

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 236 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 295

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 296 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 355

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 356 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 415

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 416 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 475

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 476 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 534

Query: 474 Q 474
           Q
Sbjct: 535 Q 535


>gi|167902784|ref|ZP_02489989.1| putative fimbriae assembly-related protein [Burkholderia
           pseudomallei NCTC 13177]
          Length = 472

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 56  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 112 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 172 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 232 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 292 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 352 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 412 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 470

Query: 474 Q 474
           Q
Sbjct: 471 Q 471


>gi|121600306|ref|YP_993003.1| CpaF [Burkholderia mallei SAVP1]
 gi|124384168|ref|YP_001026335.1| CpaF [Burkholderia mallei NCTC 10229]
 gi|126450948|ref|YP_001080391.1| CpaF [Burkholderia mallei NCTC 10247]
 gi|121229116|gb|ABM51634.1| CpaF [Burkholderia mallei SAVP1]
 gi|124292188|gb|ABN01457.1| CpaF [Burkholderia mallei NCTC 10229]
 gi|126243818|gb|ABO06911.1| CpaF [Burkholderia mallei NCTC 10247]
          Length = 520

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 104 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 159

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 160 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 219

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 220 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 279

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 280 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 339

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 340 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 399

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 400 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 459

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 460 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 518

Query: 474 Q 474
           Q
Sbjct: 519 Q 519


>gi|76810428|ref|YP_333439.1| component of type IV pilus [Burkholderia pseudomallei 1710b]
 gi|76579881|gb|ABA49356.1| component of type IV pilus [Burkholderia pseudomallei 1710b]
          Length = 521

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 105 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 160

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 161 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 220

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 221 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 280

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 281 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 340

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 341 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 400

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 401 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 460

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 461 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 519

Query: 474 Q 474
           Q
Sbjct: 520 Q 520


>gi|167824266|ref|ZP_02455737.1| type IV pilus assembly protein [Burkholderia pseudomallei 9]
          Length = 458

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 42  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 97

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 98  VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 157

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 158 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 217

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 218 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 277

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 278 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 337

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 338 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 397

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 398 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 456

Query: 474 Q 474
           Q
Sbjct: 457 Q 457


>gi|134282357|ref|ZP_01769062.1| type IV pilus assembly protein [Burkholderia pseudomallei 305]
 gi|134246395|gb|EBA46484.1| type IV pilus assembly protein [Burkholderia pseudomallei 305]
          Length = 536

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 120 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 175

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 176 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 235

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 236 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 295

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 296 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 355

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 356 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 415

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 416 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 475

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 476 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 534

Query: 474 Q 474
           Q
Sbjct: 535 Q 535


>gi|167911030|ref|ZP_02498121.1| type IV pilus assembly protein [Burkholderia pseudomallei 112]
          Length = 462

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 46  RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 101

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 102 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 161

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 162 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 221

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 222 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 281

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 282 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 341

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 342 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 401

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 402 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 460

Query: 474 Q 474
           Q
Sbjct: 461 Q 461


>gi|283779214|ref|YP_003369969.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
 gi|283437667|gb|ADB16109.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
          Length = 440

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/407 (48%), Positives = 278/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + ++K  I   L++ +D+ ++ +      R EI  ++  +   ++  ++ +E+  L E++
Sbjct: 19  FDQLKRRIHNKLVDKLDLNRVGELQGDVLRREIRLVVEHLCDTEETFLNRNERERLIEEV 78

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G GPL+ L+    I+DI++NG   +++E  GK  +T + FRDN  LL +  RIV+
Sbjct: 79  LDETFGLGPLEFLLKDPSISDILINGPKNIYVERRGKMEKTSVEFRDNAHLLQIIDRIVS 138

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDE  P+ DARL DGSRVN IIPPLALDG  ++IR+F  + L L+ L++F A T 
Sbjct: 139 KVGRRVDEVCPMVDARLTDGSRVNAIIPPLALDGAAVSIRRFGSNPLKLEDLLNFKAFTP 198

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E   LL+   + R N++I+GGTGSGKTTLLN L+ +I   ERIVT ED AE+QLQQ HVV
Sbjct: 199 EMVMLLEGAIKARLNIIIAGGTGSGKTTLLNTLSSFIPSHERIVTIEDAAEIQLQQDHVV 258

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+G IT  DLVKN LRMRPERII+GE RGPE LD+LQAMNTGHDGS+ TI
Sbjct: 259 RLETRPPNIEGKGAITATDLVKNALRMRPERIIIGECRGPETLDMLQAMNTGHDGSLTTI 318

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R+   RME MI M GF +P + +R+ I+S++ +++Q  RL+ G RR+T+I E+ G
Sbjct: 319 HANTPRDGLARMETMIMMSGFEMPMKAMRQQISSAVHLMIQASRLQGGIRRVTHITEVCG 378

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           ME + I+ QD+ KY   G DETG+  G+  +TG+ RP F  +    G
Sbjct: 379 MEQDTIVLQDIYKYVQEGIDETGRARGKFEATGI-RPSFMTKLESAG 424


>gi|242315580|ref|ZP_04814596.1| type IV pilus assembly protein [Burkholderia pseudomallei 1106b]
 gi|242138819|gb|EES25221.1| type IV pilus assembly protein [Burkholderia pseudomallei 1106b]
          Length = 536

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 120 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 175

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 176 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 235

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 236 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 295

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 296 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 355

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 356 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 415

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 416 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 475

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 476 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 534

Query: 474 Q 474
           Q
Sbjct: 535 Q 535


>gi|134291851|ref|YP_001115620.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
 gi|134135040|gb|ABO59365.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
          Length = 455

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/407 (48%), Positives = 286/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+   +  R EI+ L++ I+   ++  +  E+  L  D+
Sbjct: 33  YQKLRREIHLAVLERVELERLSRLPQEQVRHEISALISRILDEGRMPANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN   +V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLEALLRDPGVSDILVNTYRQVYVERGGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP L+IR+F  D L +D L+ F ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLLSIRRFAVDPLKIDDLLRFQSLTE 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL+ + + + NVL+SGGTGSGKTTLLN L+ +I + ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLEALAKAKVNVLVSGGTGSGKTTLLNILSGFIPRTERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G +LP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMISVAGLSLPPKTMRQQIASAITVVVQASRLTDGKRKIVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G +  G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGDIINMQEIFTFKRTGMNGDGSVRGYFCATGV-RPKFAERLQSFG 438


>gi|148261010|ref|YP_001235137.1| type II secretion system protein E [Acidiphilium cryptum JF-5]
 gi|146402691|gb|ABQ31218.1| type II secretion system protein E [Acidiphilium cryptum JF-5]
          Length = 445

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/403 (50%), Positives = 283/403 (70%), Gaps = 9/403 (2%)

Query: 70  IEMIDITQLSQYDSQS------AR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDI 121
           +EMI    LS  D+ S      AR    +  ++ E+ +  +I ++ +EQ  +  +L +D+
Sbjct: 30  VEMIRALCLSNIDASSIAGLTHARLLQRVEGMVAELATEHRIQLNRNEQNQIAAELVDDM 89

Query: 122 LGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGR 181
           LG GPL+PL+  + I DIMVNG  +VF+E  G+  +  + FRD+  L ++CQRI   VGR
Sbjct: 90  LGLGPLEPLLEDETITDIMVNGPERVFVERRGRLEQLAVRFRDSAHLANICQRIAASVGR 149

Query: 182 RVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGAR 241
           RVDESSP+ DARL DGSRVN+++PPL++DGP L+IRKF K  +    L+ +G++T   AR
Sbjct: 150 RVDESSPMVDARLKDGSRVNIVLPPLSIDGPCLSIRKFAKKPINFGKLIEYGSLTPPVAR 209

Query: 242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLET 301
           LL+I  R R NV+ISGGTGSGKTT++N ++ +ID  ER+VT ED AELQLQQPHVVRLET
Sbjct: 210 LLEIASRCRLNVIISGGTGSGKTTMMNAMSSFIDPTERVVTVEDAAELQLQQPHVVRLET 269

Query: 302 RPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANN 361
           RP N+EG+GEIT RDLV+N LRMRP+RII+GEVRGPE  D+LQAMNTGHDGSM TIHANN
Sbjct: 270 RPMNLEGKGEITQRDLVRNALRMRPDRIIIGEVRGPEAFDMLQAMNTGHDGSMSTIHANN 329

Query: 362 ARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGN 421
            R++  R+E M+ M    L  + +R  + S++++IVQ +R RDG RR+  + EI G+EG 
Sbjct: 330 TRDALARIENMVQMASMGLSPRAIRMQVVSAVNLIVQVERQRDGGRRLVQLTEIAGIEGE 389

Query: 422 VIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
             +  D+ K+EV+GED TG++IG++ +   +R  F  R   +G
Sbjct: 390 TPLLNDIFKFEVLGEDATGRIIGRY-AISHTRASFHERLNYFG 431


>gi|197295159|ref|YP_002153700.1| flp pilus assembly ATPase [Burkholderia cenocepacia J2315]
 gi|195944638|emb|CAR57242.1| flp pilus assembly ATPase [Burkholderia cenocepacia J2315]
          Length = 455

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+      R EI  L+  I+  +++  +  E+  L  D+
Sbjct: 33  YQKLRREIHLAVLERVELERLSRLHQDQVRMEIGALIARILDEERLPANDIERRQLAIDV 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  YDEMFGFGPLEALLRDPGISDILVNTYRQVYVERCGQLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV F ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRFHSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I ++ERIVT ED AELQLQQPHV+
Sbjct: 213 PMAELLDALSRAKVNVLVSGGTGSGKTTLLNILSGFIPRNERIVTIEDAAELQLQQPHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+++ G TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 333 HANTPRDALTRLENMVSVSGLTLPPKTMRQQIASAISVVVQAARLTDGKRKIISIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D  G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGDIINMQEIFTFKRTGVDRDGSVRGHFCATGV-RPKFVERLQAFG 438


>gi|197337406|ref|YP_002157815.1| TadA [Vibrio fischeri MJ11]
 gi|197314658|gb|ACH64107.1| TadA [Vibrio fischeri MJ11]
          Length = 428

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/423 (46%), Positives = 289/423 (68%), Gaps = 6/423 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y E+++ IF    +++D   ++    +   ++++  ++ ++   +  +S   + +    L
Sbjct: 8   YIEIRAQIF----DVLDAETVNSLSKEQLHNQLSNAIDLLIERHEWPVSTIVRAEYVTSL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N++ G GPLQ L+  + I+DIM+NG +K+FIE  G      ++F D EQLL + +R+ +
Sbjct: 64  VNELQGLGPLQVLMEDESISDIMINGHDKIFIERGGLVEVAPVSFIDEEQLLHIAKRVAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVD+SSP CDARL DGSRVN++IPP+A+DG +++IRKFKKD + L+ L  FGA++ 
Sbjct: 124 QVGRRVDDSSPTCDARLADGSRVNIVIPPIAIDGTSMSIRKFKKDSIGLEKLTEFGALSP 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I  R R N+LISGGTGSGKTT+LN L++YI + ERIVT ED AEL+L QPHVV
Sbjct: 184 EMAQLLMIASRCRLNILISGGTGSGKTTMLNALSQYISEKERIVTIEDAAELKLLQPHVV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR   IEG G IT +DLV N LRMRP+RII+GE RG E   +LQAMNTGHDGSM T+
Sbjct: 244 RLETRNSGIEGNGAITQQDLVINALRMRPDRIIVGECRGGEAFQMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAM+ M    LP + +R  I S++D+++Q  RL DGSR++ +I E++G
Sbjct: 304 HANTPRDAMARVEAMVMMASNNLPLEAIRRTIVSAVDIVIQISRLHDGSRKVMSITEVIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDE-TGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAEVLQS 475
           +EGN ++ ++L K+E  G++   GK+IG + +TG+  R     +A  +G E+ L  V   
Sbjct: 364 LEGNNVVLEELYKFESTGQNTPEGKIIGNYSTTGLMQRSVLVEKARFFGLEQQLKAVFNK 423

Query: 476 LEK 478
            ++
Sbjct: 424 FDE 426


>gi|217421410|ref|ZP_03452914.1| type IV pilus assembly protein [Burkholderia pseudomallei 576]
 gi|217395152|gb|EEC35170.1| type IV pilus assembly protein [Burkholderia pseudomallei 576]
          Length = 521

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 105 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQALI 160

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 161 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 220

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 221 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 280

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 281 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 340

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 341 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 400

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 401 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 460

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 461 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 519

Query: 474 Q 474
           Q
Sbjct: 520 Q 520


>gi|51245382|ref|YP_065266.1| secretory protein kinase [Desulfotalea psychrophila LSv54]
 gi|50876419|emb|CAG36259.1| probable secretory protein kinase [Desulfotalea psychrophila LSv54]
          Length = 461

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 292/427 (68%), Gaps = 12/427 (2%)

Query: 49  GNFVNRTP--------HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV-- 98
           GN V  TP         Y+E+K+ I   L +++D++ L   D +  R+EI     EI+  
Sbjct: 18  GNIVEITPGNEFGLSDEYFELKADIHDRLTKVVDLSLLDSVDEKVLREEIRNRTQEILTD 77

Query: 99  -SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
            SVK + ++  E   L +++ +++LG GPL+ L+    ++DI+VN  + V++E  GK   
Sbjct: 78  GSVKVMPINSKEHECLLQEIEDEVLGLGPLEALMKDPTVSDILVNAYHSVYVERFGKIER 137

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           T I F+DN+ L+ + ++IV+ VGRR+DE SP+ DARL DGSRVNVIIPPLAL+GP ++IR
Sbjct: 138 TKIRFKDNKHLMRIIEKIVSAVGRRIDEISPMVDARLADGSRVNVIIPPLALNGPCMSIR 197

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           +F  D L +  L     +T    +LL+ I + R NVLISGGTGSGKTTLLN ++R+I   
Sbjct: 198 RFSVDPLEMHDLQVLKTITPALGKLLEGIVQARLNVLISGGTGSGKTTLLNVMSRFISSA 257

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ER VT ED+AELQL+Q HV+RLETRP N+EG G+IT R+LV+N LRMRP+RII+GEVRG 
Sbjct: 258 ERTVTIEDSAELQLRQEHVIRLETRPANVEGAGQITQRNLVRNSLRMRPDRIIVGEVRGA 317

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           E +D+LQAMNTGH+GS+ T+HANN  ++  R+E M+ M GF L S  ++  I+S+++V++
Sbjct: 318 EAIDMLQAMNTGHEGSLTTVHANNPADALMRIETMVNMAGFNLHSDYIKRYISSAINVVI 377

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q  RL DGSR++ ++ EI GMEGNVI  Q+++ +E  G D+ G + G     GV RP+F+
Sbjct: 378 QVDRLVDGSRKVVSLSEITGMEGNVISMQEIIAFEQTGIDQVGGVSGHFEVRGV-RPKFF 436

Query: 458 NRAAQYG 464
           ++  Q G
Sbjct: 437 DKFTQMG 443


>gi|326404410|ref|YP_004284492.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
 gi|325051272|dbj|BAJ81610.1| putative type II secretion system protein [Acidiphilium multivorum
           AIU301]
          Length = 444

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/403 (50%), Positives = 283/403 (70%), Gaps = 9/403 (2%)

Query: 70  IEMIDITQLSQYDSQS------AR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDI 121
           +EMI    LS  D+ S      AR    +  ++ E+ +  +I ++ +EQ  +  +L +D+
Sbjct: 29  VEMIRALCLSNIDASSIAGLTHARLLQRVEGMVAELATEHRIQLNRNEQNQIAAELVDDM 88

Query: 122 LGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGR 181
           LG GPL+PL+  + I DIMVNG  +VF+E  G+  +  + FRD+  L ++CQRI   VGR
Sbjct: 89  LGLGPLEPLLEDETITDIMVNGPERVFVERRGRLEQLAVRFRDSAHLANICQRIAASVGR 148

Query: 182 RVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGAR 241
           RVDESSP+ DARL DGSRVN+++PPL++DGP L+IRKF K  +    L+ +G++T   AR
Sbjct: 149 RVDESSPMVDARLKDGSRVNIVLPPLSIDGPCLSIRKFAKKPINFGKLIEYGSLTPPVAR 208

Query: 242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLET 301
           LL+I  R R NV+ISGGTGSGKTT++N ++ +ID  ER+VT ED AELQLQQPHVVRLET
Sbjct: 209 LLEIASRCRLNVIISGGTGSGKTTMMNAMSSFIDPTERVVTVEDAAELQLQQPHVVRLET 268

Query: 302 RPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANN 361
           RP N+EG+GEIT RDLV+N LRMRP+RII+GEVRGPE  D+LQAMNTGHDGSM TIHANN
Sbjct: 269 RPMNLEGKGEITQRDLVRNALRMRPDRIIIGEVRGPEAFDMLQAMNTGHDGSMSTIHANN 328

Query: 362 ARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGN 421
            R++  R+E M+ M    L  + +R  + S++++IVQ +R RDG RR+  + EI G+EG 
Sbjct: 329 TRDALARIENMVQMASMGLSPRAIRMQVVSAVNLIVQVERQRDGGRRLVQLTEIAGIEGE 388

Query: 422 VIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
             +  D+ K+EV+GED TG++IG++ +   +R  F  R   +G
Sbjct: 389 TPLLNDIFKFEVLGEDATGRIIGRY-AISHTRASFHERLNYFG 430


>gi|59713406|ref|YP_206181.1| putative type IV secretion NTPase [Vibrio fischeri ES114]
 gi|59481654|gb|AAW87293.1| putative type IV secretion NTPase [Vibrio fischeri ES114]
          Length = 428

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/423 (46%), Positives = 289/423 (68%), Gaps = 6/423 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y E+++ IF    +++D   ++    +   ++++  ++ ++   +  +S   + +    L
Sbjct: 8   YIEIRAQIF----DVLDAETVNSLSKEQLHNQLSNAIDLLIERHEWPVSTIVRAEYVTSL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N++ G GPLQ L+  + I+DIM+NG +K+FIE  G      ++F D EQLL + +R+ +
Sbjct: 64  VNELQGLGPLQVLMEDESISDIMINGYDKIFIERAGLVEVAPVSFIDEEQLLHIAKRVAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVD+SSP CDARL DGSRVN++IPP+A+DG +++IRKFKKD + L+ L  FGA++ 
Sbjct: 124 QVGRRVDDSSPTCDARLADGSRVNIVIPPIAIDGTSMSIRKFKKDSIGLEKLTEFGALSQ 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+LL I  R R N+LISGGTGSGKTT+LN L++YI + ERIVT ED AEL+L QPHVV
Sbjct: 184 EMAQLLMIASRCRLNILISGGTGSGKTTMLNALSQYISEKERIVTIEDAAELKLLQPHVV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR   IEG G IT +DLV N LRMRP+RII+GE RG E   +LQAMNTGHDGSM T+
Sbjct: 244 RLETRNSGIEGNGAITQQDLVINALRMRPDRIIVGECRGGEAFQMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAM+ M    LP + +R  I S++D+++Q  RL DGSR++ +I E++G
Sbjct: 304 HANTPRDAMARVEAMVMMASNNLPLEAIRRTIVSAVDIVIQISRLHDGSRKVMSITEVIG 363

Query: 418 MEGNVIITQDLLKYEVMGEDE-TGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAEVLQS 475
           +EGN ++ ++L K+E  G++   GK+IG + +TG+  R     +A  +G E+ L  V   
Sbjct: 364 LEGNNVVLEELYKFESTGQNTPEGKIIGNYSTTGLMQRSVLVEKARFFGLEQQLKAVFNK 423

Query: 476 LEK 478
            ++
Sbjct: 424 FDE 426


>gi|167620122|ref|ZP_02388753.1| component of type IV pilus [Burkholderia thailandensis Bt4]
          Length = 472

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 278/415 (66%), Gaps = 1/415 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   TI T +   ++++          R+ I     ++++ +++T++L EQ  + E++ N
Sbjct: 58  ETFKTIRTVVFSSMNMSAALMMSRAEVREGIEQTAADVIARERLTVTLAEQALIVEEILN 117

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRDN  +++V QRI   V
Sbjct: 118 DMFGVGPIEPLLADERVTDILVNGPDQVYVERAGRLELTPLKFRDNAHVINVAQRIAAAV 177

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++   
Sbjct: 178 GRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQGNLSQAM 237

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
             +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQPHVV L
Sbjct: 238 VEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQPHVVSL 297

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGSM TIHA
Sbjct: 298 ETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGSMTTIHA 357

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + EI GME
Sbjct: 358 NTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVTEIAGME 417

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   LQ
Sbjct: 418 GDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGALQ 471


>gi|126452852|ref|YP_001066153.1| type IV pilus assembly protein [Burkholderia pseudomallei 1106a]
 gi|126226494|gb|ABN90034.1| type IV pilus assembly protein [Burkholderia pseudomallei 1106a]
          Length = 523

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 107 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 162

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 163 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 222

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 223 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 282

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 283 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 342

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 343 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 402

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 403 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 462

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 463 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 521

Query: 474 Q 474
           Q
Sbjct: 522 Q 522


>gi|320161467|ref|YP_004174691.1| putative type II/IV secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319995320|dbj|BAJ64091.1| putative type II/IV secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 471

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 278/407 (68%), Gaps = 3/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++KS + T L+  +D T          R  I  L  +I++ + I +S  E+  +FE +
Sbjct: 52  YQDLKSRVQTKLLAGLDPTA-DPSRVPEMRRTIQELFEQILTEENIVLSRPERARMFEQI 110

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             +ILG GPLQ L+  D I +IMVNG   V++E  G+     + F +NE ++ + +RIV 
Sbjct: 111 AAEILGLGPLQSLLDDDTITEIMVNGPKNVYVERGGRIYRAPVTFENNEHVMRIIERIVA 170

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRR+DES P  DARL+DGSRVN +IPP++L GP LTIRKF +  +T++ L+ FG++T 
Sbjct: 171 PLGRRIDESQPYVDARLMDGSRVNAVIPPISLVGPVLTIRKFARKPITVEQLIQFGSITP 230

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    L+     R N+++SGGTGSGKTTLLN L+ +I  DERI+T E+ AELQL+Q HVV
Sbjct: 231 EAIEFLKACVVARLNIVVSGGTGSGKTTLLNILSGFIPPDERIITIENAAELQLRQEHVV 290

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE+RPPNIEG+GEIT+R LV N LRMRP+RII+GE RG E LD+LQAMNTGHDGSM T 
Sbjct: 291 TLESRPPNIEGKGEITIRQLVINALRMRPDRIIVGECRGDEALDMLQAMNTGHDGSMTTA 350

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           H+N+ R++  R+E M  M G  LP + +RE ++S++D+IV  +R+RDGSR++ NI E+ G
Sbjct: 351 HSNSPRDTLARLETMTMMAGMELPVRAIREQVSSAIDLIVHQERMRDGSRKVVNITEVSG 410

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG+VI T DL  +E  G  E GK+IG+   TG+ RP+F ++    G
Sbjct: 411 MEGDVITTTDLFVFEQAGY-ENGKIIGRLRPTGL-RPKFMDKIEAAG 455


>gi|332188641|ref|ZP_08390357.1| type II/IV secretion system family protein [Sphingomonas sp. S17]
 gi|332011309|gb|EGI53398.1| type II/IV secretion system family protein [Sphingomonas sp. S17]
          Length = 504

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 300/454 (66%), Gaps = 5/454 (1%)

Query: 19  NPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQL 78
            P P E V +   + ++   +  PS     G   +     + +K  +   L+E +D    
Sbjct: 54  TPAPAETVDAMQRLAERQAAAVDPSPARNEGFEAS----IHRIKEQVLPRLLERVDPEAA 109

Query: 79  SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIAD 138
           +        +E   ++ E+++  K+T++  EQ  L + L +++LG GPL+ L+A  D+ D
Sbjct: 110 ATLGKDELAEEFRPIIGEVLAELKLTLNRREQFALEKVLVDELLGLGPLEELLADADVTD 169

Query: 139 IMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGS 198
           IMVNG  + ++E  GK     I FRD E L  V QRIVN VGRRVD+++P+ DARL DGS
Sbjct: 170 IMVNGPEQTYVERKGKLELAHIRFRDEEHLFQVAQRIVNSVGRRVDQTTPLADARLKDGS 229

Query: 199 RVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGG 258
           RVNVI+PPL+L G  ++IRKF    +TLD +   G+++ + A LL+I G  R N++ISGG
Sbjct: 230 RVNVIVPPLSLRGTAISIRKFSAKPITLDMMAGGGSMSNDMATLLKIAGASRFNIVISGG 289

Query: 259 TGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLV 318
           TGSGKTT+LN L++ ID  ER++T ED AEL+LQQPH + LETRP N+EG+GEI++RDLV
Sbjct: 290 TGSGKTTMLNALSKMIDPGERVLTIEDAAELRLQQPHWLPLETRPANLEGQGEISIRDLV 349

Query: 319 KNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGF 378
           KN LRMRP+RIILGE+RG E  D+L AMNTGHDGSM T+H+N+ RE+  RME M+ M   
Sbjct: 350 KNALRMRPDRIILGEIRGSECFDMLAAMNTGHDGSMCTLHSNSPREALARMENMVMMSDI 409

Query: 379 TLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDE 438
            +P + +   I  S+D+++Q +RLRDGSRR+TNI E++GMEG VIITQ+L  +  + E  
Sbjct: 410 KVPKEAISRQIADSVDMVIQVKRLRDGSRRVTNITEVIGMEGPVIITQELFSFHYLDEGS 469

Query: 439 TGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
            GK+IG++ S G+ RP   ++A Q+G ++ L E 
Sbjct: 470 DGKIIGEYRSAGL-RPYTLDKAKQFGFDQALLEA 502


>gi|89899609|ref|YP_522080.1| type II secretion system protein E [Rhodoferax ferrireducens T118]
 gi|89344346|gb|ABD68549.1| type II secretion system protein E [Rhodoferax ferrireducens T118]
          Length = 452

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/407 (47%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y + K+ I   L+  +D+  +     ++ ++E+  ++  ++  + + ++  E+ +L  D+
Sbjct: 32  YQDTKARIHQVLLGRLDLEAMENLSPENLKEELRQMVERLLLEENLVLNASERRNLVRDI 91

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             ++LG+GPL+PL+A   ++DI+VN  ++V++E  G+   T I F D++ L+ +  +IV+
Sbjct: 92  QYEMLGFGPLEPLLADPTVSDILVNTYHQVYVERRGRLELTDIKFTDDDHLMKIIDKIVS 151

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPPLA+DGP L+IR+F    L L +L+ + +++ 
Sbjct: 152 RVGRRIDESSPMVDARLPDGSRVNAIIPPLAIDGPILSIRRFATVPLKLSNLIEYRSLSD 211

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+ +  + + + N+LISGGTGSGKTTLLN L+ +I   ERIVT ED AELQLQQPHVV
Sbjct: 212 EMAQFIGALSQAKINILISGGTGSGKTTLLNILSAFISTTERIVTIEDAAELQLQQPHVV 271

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG GE+T R LV+N LRMRP+RI+LGEVRG E LD+LQAMNTGH+GSM T+
Sbjct: 272 RLETRPPNIEGRGEVTQRALVRNALRMRPDRIVLGEVRGAEALDMLQAMNTGHEGSMTTV 331

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E+MIAM G  LP++  R  + S++ VI+Q  R+ DG+R++T+I E+ G
Sbjct: 332 HANSPRDALARLESMIAMAGVDLPAKAARAQVASAIGVIIQESRMSDGTRKLTSIQEVTG 391

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG  +  Q++  +   G    G + G   +TGV RPR W+R    G
Sbjct: 392 MEGETVTLQEIFIFRQTGVGPNGAVEGHFTATGV-RPRCWDRLITRG 437


>gi|107028242|ref|YP_625337.1| type II secretion system protein E [Burkholderia cenocepacia AU
           1054]
 gi|116687153|ref|YP_840400.1| type II secretion system protein E [Burkholderia cenocepacia
           HI2424]
 gi|105897406|gb|ABF80364.1| type II secretion system protein E [Burkholderia cenocepacia AU
           1054]
 gi|116652868|gb|ABK13507.1| type II secretion system protein E [Burkholderia cenocepacia
           HI2424]
          Length = 454

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+      R EI  L+  I+  +++  +  E+  L  D+
Sbjct: 32  YQKLRREIHLAVLERVELERLSRLHQDQIRMEIGALIARILDEERLPANDIERRQLAIDV 91

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 92  YDEMFGFGPLEALLRDPGISDILVNTYRQVYVERCGQLELTDVTFYDDAHLMKVIEKIVS 151

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV + ++T 
Sbjct: 152 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRYHSLTP 211

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I ++ERIVT ED AELQLQQPHV+
Sbjct: 212 PMAELLDALSRAKVNVLVSGGTGSGKTTLLNILSGFIPRNERIVTIEDAAELQLQQPHVL 271

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 272 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 331

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+++ G TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 332 HANTPRDALTRLENMVSVSGLTLPPKTMRQQIASAISVVVQAARLTDGKRKIVSIQELTG 391

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D  G + G   +TGV RP+F  R   +G
Sbjct: 392 MEGDIINMQEIFTFKRTGVDRDGAVRGHFCATGV-RPKFAERLQAFG 437


>gi|86360587|ref|YP_472475.1| cpaF pilus assembly protein, ATPase CpaF [Rhizobium etli CFN 42]
 gi|86284689|gb|ABC93748.1| probable cpaF pilus assembly protein, ATPase CpaF [Rhizobium etli
           CFN 42]
          Length = 476

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/465 (44%), Positives = 304/465 (65%), Gaps = 10/465 (2%)

Query: 9   LMGSVKREDNNPLPQEV-VVSSSNIQKQNLQSSS--PSAEGEIGNFVNRTPHYYEVKSTI 65
           +MG   +    P  +E+ +V++ N+  Q +  S+   S E  +G      P     +  +
Sbjct: 5   IMGRFYKHQQEPESRELSLVAAQNMPAQPVSDSAMASSDEALLG------PDLVSERVNL 58

Query: 66  FTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYG 125
              L++ I++  L   D++    EI  L+ + +      ++  E  DL  D+ +++LG G
Sbjct: 59  HRYLLDRINLGILDTLDNEEIATEIRPLVKDYIRSNNFPLNAKEINDLIRDITDEMLGLG 118

Query: 126 PLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDE 185
           P++PL+A + IADI++NG N V++E +GK   T + F+D + LL V  +IV+ VGRRVDE
Sbjct: 119 PIEPLLADETIADILINGYNSVYVERSGKLESTAVRFKDEDHLLRVINKIVSAVGRRVDE 178

Query: 186 SSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQI 245
           S+P+ DARL DGSRVNV I P+++DGP ++IRKF +  LTL+ LV +GA+      LL  
Sbjct: 179 STPMVDARLKDGSRVNVAIRPISVDGPLVSIRKFTRKPLTLERLVQYGAMADAMRILLSA 238

Query: 246 IGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPN 305
             + + +++ISGGTGSGKTTLLN L+  I   ER++T ED AELQLQQPHV RLETRPP 
Sbjct: 239 AVKGKVSMVISGGTGSGKTTLLNALSSQISPKERLITIEDAAELQLQQPHVGRLETRPPT 298

Query: 306 IEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARES 365
           ++G  EI  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+GSM TIHAN  R++
Sbjct: 299 LDGRNEIRQRELLKNALRMRPDRIIVGEVRGDEAFDMLQAMNTGHEGSMTTIHANTPRDA 358

Query: 366 FGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIIT 425
            GR+E M+ M G  +    +R  I+S++ VIVQ QRL DGSR++ +I EI GMEG V+  
Sbjct: 359 VGRLEQMVGMAGMPMSQLSIRSQISSAITVIVQVQRLSDGSRKVVSISEITGMEGEVVQM 418

Query: 426 QDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLA 470
           Q+++K++ +G DE G++ G+  +TG+ RPRF    A+ G E  +A
Sbjct: 419 QEIMKFKKLGTDEGGRIHGEFRATGI-RPRFVEEFAELGIEIPVA 462


>gi|170734862|ref|YP_001773976.1| type II secretion system protein E [Burkholderia cenocepacia MC0-3]
 gi|169820900|gb|ACA95481.1| type II secretion system protein E [Burkholderia cenocepacia MC0-3]
          Length = 454

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 284/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  I   ++E +++ +LS+      R EI  L+  I+  +++  +  E+  L  D+
Sbjct: 32  YQKLRRDIHLAVLERVELERLSRLHQDQIRMEIGALIARILDEERLPANDIERRQLAIDV 91

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    I+DI+VN   +V++E  G+   T + F D+  L+ V ++IV+
Sbjct: 92  YDEMFGFGPLEALLRDPGISDILVNTYRQVYVERCGQLELTDVTFYDDAHLMKVIEKIVS 151

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +D LV + ++T 
Sbjct: 152 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAIDGPLMSIRRFAVNPLKMDDLVRYHSLTP 211

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I ++ERIVT ED AELQLQQPHV+
Sbjct: 212 PMAELLDALSRAKVNVLVSGGTGSGKTTLLNILSGFIPRNERIVTIEDAAELQLQQPHVL 271

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 272 RLETRPPNIEGKGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 331

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+++ G TLP + +R+ I S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 332 HANTPRDALTRLENMVSVSGLTLPPKTMRQQIASAISVVVQAARLTDGKRKIVSIQELTG 391

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  ++  G D  G + G   +TGV RP+F  R   +G
Sbjct: 392 MEGDIINMQEIFTFKRTGVDRDGSVRGHFCATGV-RPKFAERLQAFG 437


>gi|78062903|ref|YP_372811.1| type II secretion system protein E [Burkholderia sp. 383]
 gi|77970788|gb|ABB12167.1| type II secretion system protein E [Burkholderia sp. 383]
          Length = 474

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/474 (44%), Positives = 301/474 (63%), Gaps = 12/474 (2%)

Query: 10  MGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTP-----HYYEVKST 64
            G+  R   +P P E   ++  + ++   + +P+A         RT      H   ++S+
Sbjct: 3   FGTRNRPPADPAPAETQAATPAVARE--PAPAPTAADTPAPTPARTSVATDTHEALIRSS 60

Query: 65  IFTTLIEMIDITQLSQYDSQSARDEIATLMNEI----VSVKKITMSLDEQLDLFEDLCND 120
            F  +   +  +          RDE+   + ++    V  +++ ++  EQ+ + + + ND
Sbjct: 61  KFDAIRTAVFASMNMSAALMKTRDEVRAGIEQVAAHTVDRERLKITAGEQVLIVDAILND 120

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           + G GP++PL+A D + DI+VNG ++V++E  G+   T + FRD+  + SV QRI   VG
Sbjct: 121 MFGVGPIEPLLADDTVTDILVNGPDQVYVERAGRLELTSLKFRDDAHVASVAQRIAAAVG 180

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDESSP+ DARL DGSRVNV++PP+A+ GP+++IRKF K  +TL  +   G ++    
Sbjct: 181 RRVDESSPMVDARLADGSRVNVVLPPIAMRGPSISIRKFAKRDITLARMAQQGNISHPML 240

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           ++L++    R N++ISGGTGSGKTTLLN L+++I++ ERIVT ED AELQL QPHVV LE
Sbjct: 241 QVLKVACACRLNIVISGGTGSGKTTLLNALSQHIEQHERIVTIEDAAELQLLQPHVVSLE 300

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP N EG G I+ RDLV+N LRMRP+RIILGE+RGPE  D+LQAMNTGHDGSM TIHAN
Sbjct: 301 TRPENTEGLGGISQRDLVRNALRMRPDRIILGEIRGPEAFDVLQAMNTGHDGSMTTIHAN 360

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           + R++  R+E+M+ M    L    +R  I S++ + VQ +R+RDG RR+T I EIVGMEG
Sbjct: 361 SPRDAISRLESMVMMANANLQLLSIRRQIASAVHLFVQIERMRDGVRRVTRITEIVGMEG 420

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
            V+ITQDL  +   G+     + G   ++ + RP F  RAA YG E  LAEV +
Sbjct: 421 EVVITQDLFAFRQEGDTTRDSVKGVFEASPL-RPGFSARAAYYGVEDALAEVFR 473


>gi|226196297|ref|ZP_03791879.1| putative CpaE protein [Burkholderia pseudomallei Pakistan 9]
 gi|225931514|gb|EEH27519.1| putative CpaE protein [Burkholderia pseudomallei Pakistan 9]
          Length = 935

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 519 RSETFKTIRAVVFSSM----NMSAALMMSRAEVREGIEQAAADVIARERLTVTLAEQTLI 574

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 575 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 634

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 635 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 694

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ERIVT ED AELQLQQ
Sbjct: 695 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERIVTIEDAAELQLQQ 754

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 755 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 814

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 815 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 874

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 875 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 933

Query: 474 Q 474
           Q
Sbjct: 934 Q 934


>gi|148253055|ref|YP_001237640.1| secretory protein kinase, cpaF [Bradyrhizobium sp. BTAi1]
 gi|146405228|gb|ABQ33734.1| secretory protein kinase, cpaF [Bradyrhizobium sp. BTAi1]
          Length = 432

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 282/420 (67%), Gaps = 5/420 (1%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           ++  IF   IE +   ++SQ D   +   +  L+ EI + +KI ++ DEQ  L   + ++
Sbjct: 16  IRDQIFLR-IEPLVAVRISQQDLMVS---VNKLVAEIATGRKILLNQDEQRVLSASIVDE 71

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ++G GP++PL+    +ADI+VNG   +++E  GK   T + FR +  +L V QRI + +G
Sbjct: 72  MVGLGPIEPLLRDLSVADILVNGPRMIYVERRGKLELTKLQFRSDAHVLHVAQRIASSIG 131

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DESSP+ DARL DGSRVNVIIPPL+L GP ++IRKF +  +     V+ G ++ E A
Sbjct: 132 RRIDESSPMLDARLADGSRVNVIIPPLSLRGPCISIRKFSRSMMDFASFVTGGTLSPELA 191

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
             L+I  R R N++ISGGTGSGKTTLLN L+R ID  ERI+T ED AELQLQQ HV++LE
Sbjct: 192 SALEIAARCRLNIIISGGTGSGKTTLLNSLSRMIDPGERIITIEDAAELQLQQAHVIQLE 251

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
            RPPN+EG GEI+ RDL++N LRMRP+RII+GEVRG E  D++QAM+TGH+GSM T+HAN
Sbjct: 252 MRPPNVEGRGEISQRDLMRNALRMRPDRIIVGEVRGAEAFDMMQAMSTGHNGSMSTVHAN 311

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           +AR++ GR+E MI MG   LP + +R  I S+LD++V  +R+RDG RR+T + E+VG+EG
Sbjct: 312 SARDALGRIENMILMGSGNLPMRAIRTQIVSALDLVVHAERMRDGVRRVTEVAEVVGLEG 371

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEKQS 480
            VI    L  Y+  GE+  G L G    T V RP+F +R   +G        L  LEK +
Sbjct: 372 EVITLGSLFTYKYQGENPDGTLRGGFEPTQV-RPQFLSRLEYFGLASAFLRSLGVLEKAT 430


>gi|167842234|ref|ZP_02468918.1| component of type IV pilus [Burkholderia thailandensis MSMB43]
          Length = 476

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/421 (46%), Positives = 283/421 (67%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R+ I     ++++ +++T++L EQ  +
Sbjct: 60  RSETFRTIRAVVFSSM----NMSAALMMSRAEVREGIEQTAADMIARERLTVTLAEQALI 115

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            +++ ND+ G GP++PL+A + + DI+VNG ++V++E  GK   T + FRDN  +++V Q
Sbjct: 116 VDEILNDMFGVGPIEPLLADERVTDILVNGPDQVYVERAGKLELTPLKFRDNAHVINVAQ 175

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 176 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAIRGASISIRKFAKRNITLARMAQQG 235

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++     +L+I    R N++ISGGTGSGKTTLLN L+ +ID  ER+VT ED AELQLQQ
Sbjct: 236 NLSQAMVEVLKIASACRLNIVISGGTGSGKTTLLNALSHFIDSHERVVTIEDAAELQLQQ 295

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G ++ RDLV+N LRMRP+RIILGE RGPE  D+LQAMNTGHDGS
Sbjct: 296 PHVVSLETRPENSEGLGGVSQRDLVRNALRMRPDRIILGETRGPEAFDVLQAMNTGHDGS 355

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    LP   +R  I S++ +I+Q +R+RDG RR+T + 
Sbjct: 356 MTTIHANTPRDAITRLESMVMMANGNLPLVSIRRQIASAVHMILQIERMRDGVRRVTRVT 415

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EI GMEG+V+ITQDL  +         ++ G   S+ + RP F  RAA YG E  L   L
Sbjct: 416 EIAGMEGDVVITQDLFAFRYDASAFQEQVHGMFESSSL-RPAFAQRAAYYGLEGALLGAL 474

Query: 474 Q 474
           Q
Sbjct: 475 Q 475


>gi|116620534|ref|YP_822690.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223696|gb|ABJ82405.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 453

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/421 (48%), Positives = 287/421 (68%), Gaps = 8/421 (1%)

Query: 51  FVNR-------TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKI 103
           +VNR       TP Y E+K T+   L++ I++  LS    +  R EI   + ++V  +K 
Sbjct: 19  WVNRLFTREGSTPEYQELKFTLHRKLLDRINLEALSSMAGERVRAEIRAAVAKLVEEEKT 78

Query: 104 TMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFR 163
            +SL E+  + E++ +++ G GPL+PL+    ++DI+V   + V++E  GK   T + F+
Sbjct: 79  PLSLVEKDRVIEEILDEVFGLGPLEPLLQDPTVSDILVTTPHLVYVEKAGKLYRTPVEFK 138

Query: 164 DNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDK 223
           DN  LL + ++IV++VGRRVDESSP+ DARL DGSRVNV IPP+A+DGP L+IR+F +  
Sbjct: 139 DNAHLLRIIEKIVSRVGRRVDESSPLVDARLPDGSRVNVAIPPVAVDGPLLSIRRFGRHA 198

Query: 224 LTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTC 283
           L  + LV+  A+T     LL+   + R N+LI GGTGSGKTTLLN L+ YI +DERIVT 
Sbjct: 199 LKGEDLVAKLAMTDGMLELLKGCVKARLNILICGGTGSGKTTLLNALSSYIPEDERIVTI 258

Query: 284 EDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLL 343
           ED AEL+LQQ HV R+ETRP N+EG G I +R LV N LRMRP+RII+GEVR  E LD+L
Sbjct: 259 EDAAELRLQQTHVARMETRPANVEGTGAIHIRQLVINALRMRPDRIIVGEVRSEEALDML 318

Query: 344 QAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLR 403
           QAMNTGHDGS+ TIHAN  R+  GR+E M+ M    +  + VR  I+S++++ VQT R  
Sbjct: 319 QAMNTGHDGSLTTIHANTPRDGLGRLEVMVGMANANMGIRSVRAQISSAVNLFVQTSRFS 378

Query: 404 DGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
           DG RRIT+I E+VGME ++I  QD+  +E  G  E+GK++G+  +TG+ RP+F++R  Q 
Sbjct: 379 DGVRRITHITEVVGMEQDIITLQDIFLFEKTGITESGKVVGRFRATGI-RPKFYDRLKQS 437

Query: 464 G 464
           G
Sbjct: 438 G 438


>gi|319782176|ref|YP_004141652.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168064|gb|ADV11602.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 462

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/412 (49%), Positives = 275/412 (66%), Gaps = 7/412 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K  I   LI+  ++T L         +EI  ++ E V  + + ++  E   L  D 
Sbjct: 43  FLTLKVEIHRHLIDRFNLTALESASKDEILNEIRPIVREFVRGRTVPLNARELDQLTSDT 102

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GP++PL+  D I DIM+N   +VFIE  G   ET I FRD   LL V  +IV+
Sbjct: 103 ADEMLGLGPIEPLLKDDSITDIMINTHRRVFIERRGIVEETPIRFRDEAHLLRVINKIVS 162

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRRVDESSP+ DARL DGSRVN+ + P+++DGP ++IRKF K+  +L+ L++F ++  
Sbjct: 163 AIGRRVDESSPMVDARLEDGSRVNIAVRPISVDGPLVSIRKFSKNPYSLERLMAFNSIRP 222

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
               LL+I  + R ++L+SGGTGSGKTTLLN L+ YI   ER++T ED AELQLQQPHV 
Sbjct: 223 PMIDLLRIAVQARKSILVSGGTGSGKTTLLNALSSYIPSKERLITIEDAAELQLQQPHVG 282

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+GSM TI
Sbjct: 283 RLETRPPNVEGRGEVRQRELLKNALRMRPDRIIVGEVRGEEAFDMLQAMNTGHEGSMTTI 342

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G  +    +R  I S++D+IVQTQRL DG RR+T+I E+ G
Sbjct: 343 HANTPRDAISRLEQMVGMAGMPMTHDSIRAQIASAIDIIVQTQRLSDGGRRVTSISELTG 402

Query: 418 MEGNVIITQDLLKY---EVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           MEGNV+  Q++  +   EV  E   GK++G   +TGV RPRF   AA  G  
Sbjct: 403 MEGNVVQLQEIYHFVRREVTAE---GKVVGDFRATGV-RPRFAPEAATLGHH 450


>gi|84685158|ref|ZP_01013057.1| probable secretory protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666890|gb|EAQ13361.1| probable secretory protein [Rhodobacterales bacterium HTCC2654]
          Length = 470

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/442 (46%), Positives = 286/442 (64%), Gaps = 6/442 (1%)

Query: 15  REDNNPLPQEVVVSSSNIQKQ-NLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMI 73
           R+   P+P    V  ++ +    + + +P A    G     T  ++++K  +   ++E +
Sbjct: 11  RDARKPVPVAAGVPPTDTRNVVPMPAPAPVAHSSQGE----TSAWFDLKHRLHEIILEEV 66

Query: 74  DITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIAR 133
           ++  + + D +  R  I+ L+   ++  +I M  D    L  +L ++++G GPL+PL+A 
Sbjct: 67  NLALIEEADLKELRRAISALVVTHLNDNRIQMGSDSFKRLVGELIDEVMGLGPLEPLLAD 126

Query: 134 DDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDAR 193
           D ++DI+VNG   VF+E  G        FRD + LL +  +IV++VGRR+DES P  DAR
Sbjct: 127 DGVSDILVNGHRNVFVERGGLLERAPTTFRDEKHLLRIIDKIVSRVGRRIDESQPWVDAR 186

Query: 194 LLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNV 253
           L DGSRVN II P A+DGP+L+IRKF  DKLT++ LVS GA++   A  L      R NV
Sbjct: 187 LPDGSRVNAIIRPCAIDGPSLSIRKFSADKLTMEKLVSQGALSRNAAAFLHAAVGARMNV 246

Query: 254 LISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEIT 313
           LISGGTGSGKTT+LN L+ +ID+ +RIVT ED AELQLQQ HVVRLETRP N+EG GE++
Sbjct: 247 LISGGTGSGKTTMLNALSSFIDRRQRIVTIEDAAELQLQQEHVVRLETRPANVEGAGEVS 306

Query: 314 MRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMI 373
            R LVKN LRMRP+RI++GEVRG E  D+LQAMNTGHDGSM TIHAN AR++  R+E M+
Sbjct: 307 QRLLVKNALRMRPDRIVIGEVRGSEAFDMLQAMNTGHDGSMTTIHANTARDAISRLEQMV 366

Query: 374 AMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV 433
            M G   P   VR  + + ++++VQ  RL DG+RR+  I E+ G+EG+ I+ QD+  Y  
Sbjct: 367 VMIGNDFPLSAVRAQVAAGINIVVQLNRLSDGTRRVMAISEVYGIEGDTILMQDIFAYRR 426

Query: 434 MGEDETGKLIGQHISTGVSRPR 455
            G D  G +IG+   TGV RPR
Sbjct: 427 AGRDAEGNVIGRFGPTGV-RPR 447


>gi|322419941|ref|YP_004199164.1| type II secretion system protein E [Geobacter sp. M18]
 gi|320126328|gb|ADW13888.1| type II secretion system protein E [Geobacter sp. M18]
          Length = 434

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/407 (49%), Positives = 292/407 (71%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + ++KS I   LIE +D+ +L    S     EI  ++  ++  + + ++  E+  L  ++
Sbjct: 19  FQDLKSRIHRRLIERLDLAKLDLLGSIELNREIGYVIENLIIEEGVPLNQLERDRLIVEI 78

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G GPL+PL+A   I+DI+VN S++V++E  GK V+T + F+DN  L+ + +RIV+
Sbjct: 79  QHETFGLGPLEPLLADPHISDILVNRSSQVYVERFGKLVKTDVCFKDNAHLMQIIERIVS 138

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP  DARL DGSRVN IIPPLALDGP L+IR+F +D L ++ L++ G + A
Sbjct: 139 KVGRRIDESSPYVDARLPDGSRVNAIIPPLALDGPVLSIRRFGQDPLKMEDLLNLGTLDA 198

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
              RLL+   + R N+LISGGTG+GKTT+LN L+ YI +DER+VT ED+AELQL+Q HVV
Sbjct: 199 RMQRLLEGAVKTRLNILISGGTGTGKTTMLNVLSAYIPQDERVVTIEDSAELQLKQDHVV 258

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG GE+T RDLV+N LRMRP+RI+LGE+RG E LD+LQAMNTGHDGS+ T+
Sbjct: 259 RLETRPPNIEGRGEVTQRDLVRNALRMRPDRIVLGEIRGGEALDMLQAMNTGHDGSISTV 318

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G  LP + +RE ++S+L+VI+Q  R  DG+R++  + E+ G
Sbjct: 319 HANTTRDALARIETMVLMAGMDLPERAIREQVSSALNVIIQLVRFSDGTRKVVKLSEVTG 378

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEGN I+  D+  ++  G D+ G+++G++ +TGV RP F  R   YG
Sbjct: 379 MEGNTIVMHDVFVFDQKGIDKEGRVVGEYRATGV-RPMFAERFRVYG 424


>gi|302037434|ref|YP_003797756.1| pilus assembly ATPase CpaF [Candidatus Nitrospira defluvii]
 gi|300605498|emb|CBK41831.1| Pilus assembly ATPase CpaF [Candidatus Nitrospira defluvii]
          Length = 450

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/406 (51%), Positives = 287/406 (70%), Gaps = 1/406 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  I   L++ +D + +   D    R ++A L  +++  + ++ S  ++ ++  D+ 
Sbjct: 30  HDLKHRIHDRLLKRLDFSAMGLLDPLLLRAQLAMLTMQVLEEEGVSFSDQDREEVIADVM 89

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           N+ILG GPL+PL+    ++DI+ N S ++++E  GK   T   FRDN  L  + ++IV++
Sbjct: 90  NEILGLGPLEPLLQDPTVSDILANTSEQIYVERGGKLELTAQRFRDNTHLREIIEKIVSR 149

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DESSP+ DARL DGSRVN IIPPLALDGP L+IRKF +DKL L+HLV   A+T  
Sbjct: 150 VGRRIDESSPMVDARLEDGSRVNAIIPPLALDGPILSIRKFSRDKLQLEHLVERHALTPA 209

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
               L+ I R R NVL++GGTG GKTT+LN L+ +I  DERIVT ED AELQL+Q HVVR
Sbjct: 210 IGDTLRAIVRARLNVLVAGGTGCGKTTMLNVLSGFIPDDERIVTIEDAAELQLRQEHVVR 269

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEIT RDLV+N LRMRP+RIILGEVRG E LD+LQAMNTGHDGS+ TIH
Sbjct: 270 LETRPANVEGKGEITQRDLVRNSLRMRPDRIILGEVRGAEALDMLQAMNTGHDGSLATIH 329

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN+AR++  R+E M+AM G  LP QM+R  + S+LDVIV   R  DGSR++T++ EIVGM
Sbjct: 330 ANSARDAVTRVETMVAMAGLNLPVQMLRHYVASALDVIVHLTRFSDGSRKLTSLQEIVGM 389

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           E +VI+ Q++  +E  G    G++ G+  +TG+ RP+F  +    G
Sbjct: 390 EQDVIVLQEIFAFERTGLGADGRVKGRFGATGI-RPKFMEQVETMG 434


>gi|264678230|ref|YP_003278137.1| type II secretion system protein E [Comamonas testosteroni CNB-2]
 gi|262208743|gb|ACY32841.1| type II secretion system protein E [Comamonas testosteroni CNB-2]
          Length = 471

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/408 (47%), Positives = 283/408 (69%), Gaps = 2/408 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  ++S I   L+E  D+  L     Q+ + EIAT+   +++     ++  E+  L  D+
Sbjct: 50  YLALRSRIHAKLLERFDLAALDAVSVQTLQQEIATMTERLLTEDSAAINDLERKMLIRDI 109

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG+GPL+ L+A   ++DI+VN  +++++E  G+   T + F D + LL +  +IV+
Sbjct: 110 QHEMLGFGPLELLMADPSVSDILVNRYDQIYVERQGRLELTPVVFTDEKHLLRIIDKIVS 169

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS-FGAVT 236
           ++GRR+DESSP+ DARL DGSRVN +IPP+ALDGP ++IR+F +  L +++L++   ++T
Sbjct: 170 RIGRRIDESSPMVDARLPDGSRVNAVIPPVALDGPMMSIRRFARIPLRMENLINDLKSLT 229

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
              A +L+ + + + N++ISGGTG+GKTTLLN L+ YI   ER+VT ED AELQLQQPHV
Sbjct: 230 PGMALVLEALAKAKVNMIISGGTGAGKTTLLNILSSYIPTTERVVTIEDAAELQLQQPHV 289

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VR+ETRPPNIEG GEIT R LV+N LRMRP+RII+GEVRG E +D+LQAMNTGH+GS+ T
Sbjct: 290 VRMETRPPNIEGRGEITQRSLVRNALRMRPDRIIIGEVRGAEAVDMLQAMNTGHEGSLTT 349

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           IHAN  R+S  R+E M+ M G  LP Q  R+ I S++ V+VQ  RL DG R+IT+I EI 
Sbjct: 350 IHANTPRDSLARLENMVGMAGLNLPHQAARQQIASAITVVVQALRLTDGKRKITSIQEIT 409

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           GMEG+V+  Q++  +   G    G++ G   +TGV RP+F +R   +G
Sbjct: 410 GMEGDVVTMQEIFAFTQTGIGANGEVQGYFHATGV-RPKFADRLKGFG 456


>gi|260892927|ref|YP_003239024.1| type II secretion system protein E [Ammonifex degensii KC4]
 gi|260865068|gb|ACX52174.1| type II secretion system protein E [Ammonifex degensii KC4]
          Length = 444

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/358 (53%), Positives = 258/358 (72%), Gaps = 1/358 (0%)

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           EQ  L E+L  + LG GP+ P +   +I++IMVNG ++V++E  GK   T + FRD+  +
Sbjct: 77  EQQRLAEELVQEALGLGPITPFLEDPEISEIMVNGPHQVYVERKGKLELTPVTFRDDAHV 136

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           L + +RIV  +GRR+DES P+ DARL DGSRVN IIPPL+L+GP LTIRKF    LT++ 
Sbjct: 137 LQIIERIVAPLGRRIDESVPMVDARLPDGSRVNAIIPPLSLNGPVLTIRKFSATPLTMED 196

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+  G +T   AR L+   + R N+++SGGTGSGKTTLLN L+ +I  DERI+T ED AE
Sbjct: 197 LIRLGTLTPSMARFLEACVKARLNIVVSGGTGSGKTTLLNVLSSFIPPDERIITIEDAAE 256

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL+Q HVVRLE+RPPNIEG+G +T+RDLV+N LRMRP+RI++GEVRG E LD+LQAMNT
Sbjct: 257 LQLRQEHVVRLESRPPNIEGKGAVTIRDLVRNALRMRPDRIVVGEVRGGEALDMLQAMNT 316

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GHDGS+ T HAN+ R+   R+E M+ M G  LP + +RE I S+LD+IV   R +DGSR+
Sbjct: 317 GHDGSLTTAHANSPRDLLSRLETMVLMAGMELPVRAIREQIASALDLIVHASRFKDGSRK 376

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           +T+I E+ GMEG+VI+ QDL  +   G    GK++G+ + TG+ RPR   R A  G E
Sbjct: 377 VTHITEVQGMEGDVIVLQDLFLFRQTGVGPDGKVLGEFVCTGI-RPRCAERLAAAGIE 433


>gi|299532599|ref|ZP_07045988.1| type II secretion system protein E [Comamonas testosteroni S44]
 gi|298719402|gb|EFI60370.1| type II secretion system protein E [Comamonas testosteroni S44]
          Length = 471

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/442 (45%), Positives = 295/442 (66%), Gaps = 6/442 (1%)

Query: 24  EVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDS 83
           +VV  S+++         P +    G+    +  Y  ++S I   L+E  D+  L     
Sbjct: 20  QVVSESADMSAMPATEPPPPSTPIYGH----SAAYLALRSRIHAKLLERFDLAALDAVSV 75

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q+ + EIAT+   +++     ++  E+  L  D+ +++LG+GPL+ L+A   ++DI+VN 
Sbjct: 76  QTLQQEIATMTERLLAEDSAAINDLERKMLIRDIQHEMLGFGPLELLMADPAVSDILVNR 135

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
            +++++E  G+   T + F D + LL +  +IV+++GRR+DESSP+ DARL DGSRVN +
Sbjct: 136 YDQIYVERRGRLELTPVVFTDEKHLLRIIDKIVSRIGRRIDESSPMVDARLPDGSRVNAV 195

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVS-FGAVTAEGARLLQIIGRIRCNVLISGGTGSG 262
           IPP+ALDGP ++IR+F    L +++L++   ++T   A +L+ + + + N++ISGGTG+G
Sbjct: 196 IPPVALDGPMMSIRRFAHIPLRMENLINDLKSLTPGMALVLEALAKAKVNMIISGGTGAG 255

Query: 263 KTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCL 322
           KTTLLN L+ YI   ER+VT ED AELQLQQPHVVR+ETRPPNIEG GEIT R LV+N L
Sbjct: 256 KTTLLNILSSYIPAVERVVTIEDAAELQLQQPHVVRMETRPPNIEGRGEITQRSLVRNAL 315

Query: 323 RMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPS 382
           RMRP+RII+GEVRG E +D+LQAMNTGH+GS+ TIHAN  R+S  R+E M+ M G  LP 
Sbjct: 316 RMRPDRIIIGEVRGAEAVDMLQAMNTGHEGSLTTIHANTPRDSLARLENMVGMAGLNLPH 375

Query: 383 QMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKL 442
           Q  R+ I S++ V+VQ  RL DG R+IT+I EI GMEG+V+  Q++  +   G   +G++
Sbjct: 376 QAARQQIASAITVVVQALRLTDGKRKITSIQEITGMEGDVVTMQEIFAFTQTGVGASGEV 435

Query: 443 IGQHISTGVSRPRFWNRAAQYG 464
            G   +TGV RP+F +R   +G
Sbjct: 436 QGYFHATGV-RPKFADRLKGFG 456


>gi|320101693|ref|YP_004177284.1| type II secretion system protein E [Isosphaera pallida ATCC 43644]
 gi|319748975|gb|ADV60735.1| type II secretion system protein E [Isosphaera pallida ATCC 43644]
          Length = 527

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/407 (47%), Positives = 278/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K  I   L++ +D ++L + D  + + E+  L+  ++  +   ++  ++ ++ +++
Sbjct: 106 FDSLKRQIHLQLVDKLDFSKLGEMDQGTLKTEVKALIETLIDEQNPIINRQKRSEIVKEI 165

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+  D I DIM+NG   +FIE  GK  +T + F+DN+ LL +  RIV 
Sbjct: 166 MDEVFGFGPLELLLKDDKIGDIMINGPKTIFIEKGGKIQKTDVVFKDNQHLLQIIDRIVA 225

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDE+SP+ DARL +GSR N IIPPLALDGP +TIR F    L  + L+ F A T 
Sbjct: 226 RVGRRVDETSPMVDARLPNGSRFNAIIPPLALDGPAVTIRVFGSKPLGKEDLLKFKAFTP 285

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E   +L+   + R NV+ISGGTGSGKTTLLN L+ +I  DER++T ED AELQLQQPHVV
Sbjct: 286 EMILMLEGAMKARLNVVISGGTGSGKTTLLNTLSSFIPHDERVITIEDAAELQLQQPHVV 345

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG+G +T  DLVKN LRMRP+RII+GE RG E LD++QAMNTGH+GSM T+
Sbjct: 346 RLETRPANIEGKGAVTATDLVKNALRMRPDRIIIGECRGAETLDMIQAMNTGHEGSMTTV 405

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI+M G  LP + +R+   S++D+I+Q  RL+ G R++T+I E+V 
Sbjct: 406 HANTPRDAIARLETMISMAGLELPIRALRQQFASAIDLIIQANRLQGGPRKVTSITEVVN 465

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG+ II Q++  ++    DETG+  GQ    G+ RP F +R    G
Sbjct: 466 MEGDTIIMQEIFGFKQTHVDETGRAHGQFWCHGI-RPTFMDRLEAKG 511


>gi|121534349|ref|ZP_01666173.1| type II secretion system protein E [Thermosinus carboxydivorans
           Nor1]
 gi|121307119|gb|EAX48037.1| type II secretion system protein E [Thermosinus carboxydivorans
           Nor1]
          Length = 455

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/437 (48%), Positives = 299/437 (68%), Gaps = 7/437 (1%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLS-----QYDSQSAR 87
           QKQ+ Q    + + +    V   P Y  +K  I   +I+ + + +         D Q+  
Sbjct: 10  QKQSEQPGKGAEKAKPFLPVKSDP-YQNLKVRIHKRIIDEMSLEESKVLTDQDADRQALE 68

Query: 88  DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           + +A +   ++  +   +   ++  +  ++ +++LGYGP+ PL+  D I++IMVNG N+V
Sbjct: 69  EVVARIATAVMDEEAAPVPRGDRGRIIAEVVDEVLGYGPIDPLLKDDTISEIMVNGPNQV 128

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           ++E  GK V T + FRD+  ++ V ++IV  +GRR+DESSP+ DARL DGSRVN IIPPL
Sbjct: 129 YVERKGKLVLTDVRFRDDAHVMHVIEKIVAPLGRRIDESSPMVDARLPDGSRVNAIIPPL 188

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           AL GP LTIRKF KD LT+  L++FG +T E A  L+     + N+++SGGTGSGKTT L
Sbjct: 189 ALKGPCLTIRKFAKDPLTIQDLINFGTLTEEMANFLKACVEGKLNIVVSGGTGSGKTTTL 248

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           NCL+ +I  DERI+T ED AELQL+Q HVV LETRPPNIEG+G ITMRDLV+N LRMRP+
Sbjct: 249 NCLSSFIPPDERIITIEDAAELQLRQEHVVTLETRPPNIEGKGAITMRDLVRNSLRMRPD 308

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RI++GEVR  E LD+LQAMNTGHDGS+ T HAN+ R+   R+E M+ M G  LP + +RE
Sbjct: 309 RIVVGEVRSGEALDMLQAMNTGHDGSLTTGHANSPRDMLSRLETMVLMAGMDLPVRAIRE 368

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHI 447
            I S++D+IVQ  RLRDGSR+IT++ E+ GMEG+VI  QD+  +E  G+DE+GK+IG++ 
Sbjct: 369 QIASAIDLIVQQARLRDGSRKITHLTEVQGMEGDVITLQDIFVFEQTGKDESGKIIGRYR 428

Query: 448 STGVSRPRFWNRAAQYG 464
            TG+ RP+F  + A  G
Sbjct: 429 PTGI-RPKFLEKLAANG 444


>gi|46580527|ref|YP_011335.1| type II/IV secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449946|gb|AAS96595.1| type II/IV secretion system protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 477

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 219/463 (47%), Positives = 311/463 (67%), Gaps = 11/463 (2%)

Query: 12  SVKREDN---NPLPQEVVVSSSNIQKQNLQS--SSPSAEGEIGNFVNRT---PHYYEVKS 63
           S +R D+   +P   E   ++    +Q L++  S+P A  ++ +    T    HYYE+K 
Sbjct: 6   SSRRTDDATVSPAAAETQATAPAQAEQPLRAARSTPRAAEQVVDVSKLTLHGDHYYEIKE 65

Query: 64  TIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLFEDLCNDI 121
            +   L+E++D+  +     +   DEI  L+  ++    ++  ++  E+  +  D+ ++I
Sbjct: 66  HLLDRLLELLDLAAVESLPPERLGDEIGRLVERLMRDEFRQAPLNASERRQITGDIRDEI 125

Query: 122 LGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGR 181
           LG GPL+PL+    + DI+VN   ++++E  GK ++    F+D++ L  +  RIV+++GR
Sbjct: 126 LGLGPLEPLLHDPTVNDILVNNYRQIYVERRGKLIKVNTRFQDDDHLRKIIDRIVSRIGR 185

Query: 182 RVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGAR 241
           RVDESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F KD L L  L+ FGA+T E   
Sbjct: 186 RVDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFSKDPLELHDLIGFGALTPEMGE 245

Query: 242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLET 301
           +LQ I + R N+++SGGTGSGKTT+LNCL+R++  DERIVT ED AELQL+Q HVVRLET
Sbjct: 246 VLQGIVKARLNIIVSGGTGSGKTTMLNCLSRFVPHDERIVTIEDAAELQLKQEHVVRLET 305

Query: 302 RPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANN 361
           RP NIEG GE+T RDLVKNCLRMRP+RII+GEVR  EVLD+LQAMNTGHDGS+ TIHAN 
Sbjct: 306 RPANIEGHGEVTARDLVKNCLRMRPDRIIVGEVRSGEVLDMLQAMNTGHDGSLTTIHANT 365

Query: 362 ARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGN 421
            R+   R+E M+AM G  + +  ++  I+S++DVI+Q  RL DGSR++T++ E+ GMEG 
Sbjct: 366 PRDCLMRLETMVAMAGLNISTLSLKRYISSAVDVIIQVSRLSDGSRKLTSLMELTGMEGE 425

Query: 422 VIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            I  Q++  +E  G D+ GK+ G H  +G  RP F  R A  G
Sbjct: 426 AITMQEIYSFEQTGVDDKGKVQG-HFRSGGIRPNFAPRLAAMG 467


>gi|120602156|ref|YP_966556.1| type II secretion system protein E [Desulfovibrio vulgaris DP4]
 gi|120562385|gb|ABM28129.1| type II secretion system protein E [Desulfovibrio vulgaris DP4]
 gi|311234266|gb|ADP87120.1| type II secretion system protein E [Desulfovibrio vulgaris RCH1]
          Length = 608

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 221/471 (46%), Positives = 313/471 (66%), Gaps = 11/471 (2%)

Query: 4   RRDKKLMGSVKREDN---NPLPQEVVVSSSNIQKQNLQS--SSPSAEGEIGNFVNRT--- 55
           RR      S +R D+   +P   E   ++    +Q L++  S+P A  ++ +    T   
Sbjct: 129 RRPVVAPSSSRRTDDATVSPAAAETQATAPAQAEQPLRAARSTPRAAEQVVDVSKLTLHG 188

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDL 113
            HYYE+K  +   L+E++D+  +     +   DEI  L+  ++    ++  ++  E+  +
Sbjct: 189 DHYYEIKEHLLDRLLELLDLAAVESLPPERLGDEIGRLVERLMRDEFRQAPLNASERRQI 248

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             D+ ++ILG GPL+PL+    + DI+VN   ++++E  GK ++    F+D++ L  +  
Sbjct: 249 TGDIRDEILGLGPLEPLLHDPTVNDILVNNYRQIYVERRGKLIKVNTRFQDDDHLRKIID 308

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+++GRRVDESSP+ DARL DGSRVN IIPPLALDGP+L+IR+F KD L L  L+ FG
Sbjct: 309 RIVSRIGRRVDESSPMVDARLADGSRVNAIIPPLALDGPSLSIRRFSKDPLELHDLIGFG 368

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T E   +LQ I + R N+++SGGTGSGKTT+LNCL+R++  DERIVT ED AELQL+Q
Sbjct: 369 ALTPEMGEVLQGIVKARLNIIVSGGTGSGKTTMLNCLSRFVPHDERIVTIEDAAELQLKQ 428

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HVVRLETRP NIEG GE+T RDLVKNCLRMRP+RII+GEVR  EVLD+LQAMNTGHDGS
Sbjct: 429 EHVVRLETRPANIEGHGEVTARDLVKNCLRMRPDRIIVGEVRSGEVLDMLQAMNTGHDGS 488

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + TIHAN  R+   R+E M+AM G  + +  ++  I+S++DVI+Q  RL DGSR++T++ 
Sbjct: 489 LTTIHANTPRDCLMRLETMVAMAGLNISTLSLKRYISSAVDVIIQVSRLSDGSRKLTSLM 548

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           E+ GMEG  I  Q++  +E  G D+ GK+ G H  +G  RP F  R A  G
Sbjct: 549 ELTGMEGEAITMQEIYSFEQTGVDDKGKVQG-HFRSGGIRPNFAPRLAAMG 598


>gi|327189773|gb|EGE56917.1| type II secretion system protein E [Rhizobium etli CNPAF512]
          Length = 482

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 278/402 (69%), Gaps = 1/402 (0%)

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           L++ I++  L   D++    EI  L+ + +      ++  E  DL  D+ +++LG GP++
Sbjct: 68  LLDRINLGILDTLDNEEIATEIRPLVKDYIRTNNFPLNAKEINDLIRDITDEMLGLGPVE 127

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSP 188
           PL+A D IADI++NG N V++E  GK   T + F+D + LL V  +IV+ VGRRVDES+P
Sbjct: 128 PLLADDTIADILINGYNSVYVERRGKLESTAVRFKDEDHLLRVINKIVSAVGRRVDESTP 187

Query: 189 ICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR 248
           + DARL DGSRVNV I P+++DGP ++IRKF +  LTL+ LV +GA+      LL    +
Sbjct: 188 MVDARLKDGSRVNVAIRPISVDGPLVSIRKFTRKPLTLERLVQYGAMADAMRILLSAAVK 247

Query: 249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEG 308
            + +++ISGGTGSGKTTLLN L+  I   ER++T ED AELQLQQPHV RLETRPP ++G
Sbjct: 248 GKVSMVISGGTGSGKTTLLNALSSQISPKERLITIEDAAELQLQQPHVGRLETRPPTLDG 307

Query: 309 EGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGR 368
             EI  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+GSM TIHAN  R++ GR
Sbjct: 308 RNEIRQRELLKNALRMRPDRIIVGEVRGDEAFDMLQAMNTGHEGSMTTIHANTPRDAVGR 367

Query: 369 MEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL 428
           +E M+ M G  +    +R  I+S++ +IVQ QRL DGSR++ +I EI GMEG V+  Q++
Sbjct: 368 LEQMVGMAGMPMSQLSIRSQISSAITIIVQVQRLSDGSRKVVSISEITGMEGEVVQMQEI 427

Query: 429 LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLA 470
           +K++ +G DE G++ G+  +TG+ RPRF    A+ G E  +A
Sbjct: 428 MKFKKLGTDEGGRIHGEFRATGI-RPRFVEEFAELGIEIPVA 468


>gi|148553552|ref|YP_001261134.1| type II secretion system protein E [Sphingomonas wittichii RW1]
 gi|148498742|gb|ABQ66996.1| type II secretion system protein E [Sphingomonas wittichii RW1]
          Length = 521

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/414 (48%), Positives = 289/414 (69%), Gaps = 1/414 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           +++K  +   L+E +D    +        +E   ++ E+++  +IT++  EQ  L + L 
Sbjct: 107 HKIKEQVLPRLLERVDPEAAASLSKDELAEEFRPIIGEVLAELRITLNRREQFALEKVLI 166

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++LG GPL+ L++   I DIMVNG  + ++E  GK     + FRD E L  + QRIV++
Sbjct: 167 DELLGLGPLEELLSDPLITDIMVNGPEQTYVERKGKLELAKVTFRDEEHLFQIAQRIVSK 226

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRRVD+++P+ DARL DGSRVNVI+PPL+L G  ++IRKF    +TLD +   G+++ +
Sbjct: 227 VGRRVDQTTPLADARLTDGSRVNVIVPPLSLRGTAISIRKFSSKPITLDMMARSGSMSEQ 286

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A +L+I G  R N++ISGGTGSGKTT+LN L++ ID  ER+VT ED AEL+LQQPH + 
Sbjct: 287 MATMLKIAGASRFNIVISGGTGSGKTTMLNALSKMIDPGERVVTIEDAAELRLQQPHWLP 346

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+G IT+RDLV N LRMRP+RIILGE+RGPE  D+L AMNTGHDGSM T+H
Sbjct: 347 LETRPANLEGQGAITIRDLVVNALRMRPDRIILGEIRGPECFDMLAAMNTGHDGSMCTLH 406

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           +N+ RE+  RME M+ M    +P + + + I  S+D+IVQ +RLRDGSRR+T+I E++GM
Sbjct: 407 SNSPREALARMENMVMMSDIKVPKEAISKQIADSVDLIVQVKRLRDGSRRVTSITEVLGM 466

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEV 472
           EG VIITQ+L K+E   ED  G++IG+  ++G+ RP    +A Q+G ++ L E 
Sbjct: 467 EGPVIITQELFKFEYHAEDSEGRIIGEFATSGL-RPYTIEKARQFGFDQPLLEA 519


>gi|153006803|ref|YP_001381128.1| type II secretion system protein E [Anaeromyxobacter sp. Fw109-5]
 gi|152030376|gb|ABS28144.1| type II secretion system protein E [Anaeromyxobacter sp. Fw109-5]
          Length = 449

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/409 (49%), Positives = 276/409 (67%), Gaps = 1/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           ++++KS +   +I+ +D+    +   +  RDE+  +++  +   ++ ++  E+  +  +L
Sbjct: 30  FHDLKSELHRRIIDKLDLQAFDRLAPERRRDELRAVLSGEIGRSELPLNQLERERMIGEL 89

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+PL+A   I+DI+VN  + V++E  GK   T + F  N  L  +  RIV 
Sbjct: 90  LDELTGLGPLEPLLADSTISDILVNTYSTVYVERRGKLELTAVRFGSNGHLQQIINRIVA 149

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVDE+SP+ DARL DGSRVN IIPPLA+DGP L+IR+F    L +  LV+ GA+T 
Sbjct: 150 QVGRRVDETSPMVDARLADGSRVNAIIPPLAIDGPILSIRRFGVSPLKVRDLVTNGALTP 209

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    L    + + NVLISGGTG+GKTTLLN L+ +I   ERIVT ED+AELQLQQ HVV
Sbjct: 210 EAVGFLGACVKAKLNVLISGGTGAGKTTLLNALSSFIPDTERIVTIEDSAELQLQQRHVV 269

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG+GEI  RDLVKN LRMRP+RI++GEVRG EVLD+LQAMNTGH+GSM T+
Sbjct: 270 RLETRPANIEGKGEIIARDLVKNALRMRPDRIVVGEVRGGEVLDMLQAMNTGHEGSMTTV 329

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAMI M G  L     R  I+ +L++I Q  R  DG RRI +I EI G
Sbjct: 330 HANTPRDALSRIEAMIGMSGVPLSEGATRATISRALNIIAQLNRGTDGRRRIMSIAEITG 389

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
            EG  I  Q++ ++E  G D TGK+IG+ I TG+ R R   R AQ+G +
Sbjct: 390 TEGAAITMQEIYRFEQRGVDSTGKVIGEFIPTGI-RARAMTRIAQFGAD 437


>gi|319951071|ref|ZP_08024924.1| type II secretion system protein E [Dietzia cinnamea P4]
 gi|319435231|gb|EFV90498.1| type II secretion system protein E [Dietzia cinnamea P4]
          Length = 476

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/372 (51%), Positives = 267/372 (71%), Gaps = 2/372 (0%)

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           +N++V  + + ++ D++  L  D+  D+LG+GPL+ L+   DI +IMVNG + +F+E  G
Sbjct: 87  LNKVVEDETVPLTGDQRQRLISDVQADVLGHGPLEKLLEDPDITEIMVNGPDMIFVERAG 146

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           +       F   + L  V +RIV+++GRRVDESSP+ DARL DGSRVN +IPPLA++G +
Sbjct: 147 QLTRHPSRFTSEDHLRQVIERIVSRIGRRVDESSPLVDARLADGSRVNAVIPPLAVNGSS 206

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           LTIRKF KD   +  L+ FG +T E A +LQ   + R N+++SGGTGSGKTTLLN L+ +
Sbjct: 207 LTIRKFSKDPFQVHDLIRFGTLTPEMAEVLQACVQARLNIIVSGGTGSGKTTLLNVLSSF 266

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           I + ERIVT ED  ELQLQQ HVVRLE+RP NIEG GEIT+R+LV+N LRMRP+RI++GE
Sbjct: 267 IPEGERIVTIEDAVELQLQQDHVVRLESRPANIEGRGEITIRELVRNSLRMRPDRIVVGE 326

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
           VRG E LD+LQAMNTGHDGS+ T+H+N+ R++  R+E ++ M G  +P + +RE I S++
Sbjct: 327 VRGGETLDMLQAMNTGHDGSLSTVHSNSPRDAIARLETLVLMAGMDIPLRAIREQIASAV 386

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQHISTGVS 452
           DVI+Q  RLRDG+RRIT + E+ GMEG  +  QD   ++   G    GK +G+ ++TGV 
Sbjct: 387 DVIIQLTRLRDGTRRITAVTEVQGMEGQTVTLQDAFLFDYSAGVGPDGKFLGKPVATGV- 445

Query: 453 RPRFWNRAAQYG 464
           RPRF +R A+ G
Sbjct: 446 RPRFTDRFAELG 457


>gi|262275466|ref|ZP_06053276.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Grimontia hollisae CIP 101886]
 gi|262220711|gb|EEY72026.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Grimontia hollisae CIP 101886]
          Length = 425

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 261/358 (72%), Gaps = 1/358 (0%)

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + +++ G GP+Q LI  D I+DIMVNG   +FIE +G   ++ + F D  QL++V +RI 
Sbjct: 63  MYDELRGLGPIQTLIEDDSISDIMVNGPKDIFIERHGLVEKSSVTFIDEAQLVTVAKRIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
             VGRRVDES+P+CDARL DGSRVN+++PP+A+DG +++IRKFKK  +    L+ FGA++
Sbjct: 123 AAVGRRVDESAPLCDARLSDGSRVNIVLPPIAIDGASISIRKFKKQSIGFPELIEFGAMS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A+L+ I  R R N++ISGGTGSGKTT++N L++YI + ERIVT ED AEL+LQQPHV
Sbjct: 183 PEVAKLMMIASRCRLNIVISGGTGSGKTTMMNALSQYISEKERIVTIEDAAELRLQQPHV 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETRP  IEG GE+  R LV N LRMRP+RI++GE RGPE  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRPAGIEGTGEVNQRHLVINSLRMRPDRIVIGECRGPETFEMLQAMNTGHDGSMTT 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HANN R++  R+E+M+ M   +LP + +R  + S++D+I+Q  RL DGSR++ +I E+V
Sbjct: 303 LHANNPRDAISRIESMVMMATSSLPLEAIRRTVVSAIDIIIQISRLHDGSRKVMSISEVV 362

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAEVL 473
           GMEG  ++ +++ ++E  G  ++GK++G  +++G+  R   + +A  +G +  L  + 
Sbjct: 363 GMEGQSVVMEEIFRFEQKGLSDSGKVLGDFVTSGLMQRSALYEKARYFGLDTELNSIF 420


>gi|221633002|ref|YP_002522227.1| CpaF [Thermomicrobium roseum DSM 5159]
 gi|221157161|gb|ACM06288.1| CpaF [Thermomicrobium roseum DSM 5159]
          Length = 483

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 288/431 (66%), Gaps = 15/431 (3%)

Query: 38  QSSSPSAEGEIGNFVNRTP------------HYYEVKSTIFTTLIEMIDITQLSQYDSQS 85
           QS  P   G++   + R               + ++K  +   +I  +D  ++   D   
Sbjct: 30  QSRGPMGTGQLAQTLKRPSLRASAAASSNENAFQQLKGRVQQRVIAELD-PRMDLSDPDR 88

Query: 86  ARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSN 145
            R  +      ++  + I +   E+  LFE +  +ILGYGP++PL+  + + +IMVNG  
Sbjct: 89  VRRTLEETFLSVLESEGIVLGRTERHRLFEAIVAEILGYGPIEPLLKDNTVTEIMVNGPK 148

Query: 146 KVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIP 205
           +V++E NGK  +T I F D++ ++ +  RIV+ +GRR+DESSP+ DARL DGSR+N +IP
Sbjct: 149 QVWVERNGKLEKTAIEFDDDDHVMRIIDRIVSPLGRRIDESSPMVDARLPDGSRINAVIP 208

Query: 206 PLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTT 265
           P++L GP LTIRKF +D LT+D L+ FG +T E  + L+     R N+++SGGTGSGKTT
Sbjct: 209 PISLVGPCLTIRKFSRDPLTVDDLIRFGTMTPEITQFLKACVNARLNIVVSGGTGSGKTT 268

Query: 266 LLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR 325
           LLN L+ +I  DERIVT E+ AELQL+Q HVV LE+RPPNIEG+GE+T+RDLV N LRMR
Sbjct: 269 LLNVLSSFIPSDERIVTIENAAELQLRQEHVVTLESRPPNIEGKGEVTIRDLVINALRMR 328

Query: 326 PERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMV 385
           P+RI++GE RG E LD+LQAMNTGHDGSM T+H+N+ R++  R+E M+ M G  LP + +
Sbjct: 329 PDRIVVGECRGGEALDMLQAMNTGHDGSMTTVHSNSPRDTLHRLETMVLMAGMDLPVRAI 388

Query: 386 REIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQ 445
           RE I S+LD+I+   RL+DGSR+I  I E+ GMEG+VI+ QD+  +E  G  E GK++G+
Sbjct: 389 REQIASALDLIIHMARLKDGSRKIVAITEVQGMEGDVIVLQDIFVFEQTGF-ENGKVLGR 447

Query: 446 HISTGVSRPRF 456
              TGV RP+F
Sbjct: 448 IRPTGV-RPKF 457


>gi|209809173|ref|YP_002264711.1| type II/IV secretion system protein, ATP binding domain [Aliivibrio
           salmonicida LFI1238]
 gi|208010735|emb|CAQ81126.1| type II/IV secretion system protein, ATP binding domain [Aliivibrio
           salmonicida LFI1238]
          Length = 428

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/414 (46%), Positives = 286/414 (69%), Gaps = 6/414 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y E+++ IF    E ++   ++    +    +++  ++ ++  ++ ++S   + +    L
Sbjct: 8   YIEIRNQIF----EALEAEAVNSLSKEQLSKQLSGAIDLLIERREWSVSTMIRAEFVTSL 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQ L+  D I+DIM+NG N++FIE NG      ++F D EQL+ + +RI +
Sbjct: 64  VDELQGLGPLQVLMEDDSISDIMINGHNQIFIERNGLVEVAPVSFIDEEQLIHIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRRVD+SSP CDARL DGSRVN++IPP+A+DG +++I KFKKD + LD L  FGA++ 
Sbjct: 124 QVGRRVDDSSPTCDARLQDGSRVNIVIPPIAIDGTSMSISKFKKDSIGLDKLTEFGALSP 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A++L I  R R N+LISGGTGSGKTT+LN L+++I + ERI+T ED AEL+L QPHVV
Sbjct: 184 EMAQILMIASRCRLNILISGGTGSGKTTMLNALSQFISEKERIITIEDAAELKLLQPHVV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR   IEG G IT RDLV N LRMRP+RI++GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RLETRNSGIEGTGAITQRDLVINALRMRPDRIVVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+EAM+ M    LP + +R  I S++D+++Q  RL DGSR++ +I E+VG
Sbjct: 304 HANTPRDAMARVEAMVMMASNNLPLEAIRRTIVSAVDLVIQISRLHDGSRKVMSITEVVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDET-GKLIGQHISTGV-SRPRFWNRAAQYGEEKNL 469
           +EGN ++ ++L K+   G+  + GK++GQ+ + G+  R     +A  +G E+ L
Sbjct: 364 LEGNNVVLEELYKFHSSGQHGSDGKILGQYSTAGLMQRSVLVEKARFFGLEQQL 417


>gi|209546476|ref|YP_002278394.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537720|gb|ACI57654.1| type II secretion system protein E [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 481

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 283/418 (67%), Gaps = 1/418 (0%)

Query: 49  GNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLD 108
           G  V+  P     +  +   L++ I++  L   D++    EI  L+ + +      ++  
Sbjct: 47  GEEVSLGPDMVSERVNLHRYLLDRINLGILDTLDNEEIATEIRPLVKDYIRTNNFPLNAK 106

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E  DL  D+ +++LG GP++PL+A D IADI++NG N V++E +GK   T + F+D + L
Sbjct: 107 EINDLIRDITDEMLGLGPIEPLLADDTIADILINGYNSVYVERSGKLESTAVRFKDEDHL 166

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           L V  +IV+ VGRRVDES+P+ DARL DGSRVNV I P+++DGP ++IRKF +  LT++ 
Sbjct: 167 LRVINKIVSAVGRRVDESTPMVDARLKDGSRVNVAIRPISVDGPLVSIRKFTRKPLTMER 226

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           LV +GA+      LL    + + +++ISGGTGSGKTTLLN L+  I   ER++T ED AE
Sbjct: 227 LVQYGAMADAMRILLSAAVKGKVSMVISGGTGSGKTTLLNALSSQISPKERLITIEDAAE 286

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQLQQPHV RLETRPP ++G  EI  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNT
Sbjct: 287 LQLQQPHVGRLETRPPTLDGRNEIRQRELLKNALRMRPDRIIVGEVRGDEAFDMLQAMNT 346

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GSM TIHAN  R++ GR+E M+ M G  +    +R  I+S++ +IVQ QRL DG+R+
Sbjct: 347 GHEGSMTTIHANTPRDAVGRLEQMVGMAGMPMSQVSIRSQISSAITMIVQVQRLSDGTRK 406

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           + +I EI GMEG V+  Q+++K++ +G DE G++ G+  +TG+ RPRF    A+ G E
Sbjct: 407 VVSISEITGMEGEVVQMQEIMKFKKIGTDEGGRIHGEFRATGI-RPRFVEEFAELGIE 463


>gi|260462611|ref|ZP_05810817.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
 gi|259031517|gb|EEW32787.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
          Length = 457

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/415 (47%), Positives = 276/415 (66%), Gaps = 4/415 (0%)

Query: 55  TPH---YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
            PH   +  +K  +   LI+  ++T L         +EI  ++ E V  + + ++  E  
Sbjct: 32  APHGDEFLALKVDLHRHLIDRFNLTALETASKDEILNEILPIVREFVRGRNVPLNARELD 91

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            L  D  +++LG GP++PL+  D IADI++N   +VFIE  G   ET I FRD   LL V
Sbjct: 92  QLTSDTADEMLGLGPIEPLLKDDSIADILINTHKRVFIERRGVIEETSIRFRDEAHLLRV 151

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
             +IV+ +GRRVDES+P+ DARL DGSRVN+ + P+++DGP ++IRKF K+  +L+ L+ 
Sbjct: 152 INKIVSAIGRRVDESAPMVDARLEDGSRVNIAVRPISVDGPLVSIRKFSKNPYSLERLMV 211

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
             ++      LL+I  + R ++L+SGGTGSGKTTLLN L+ YI   ER++T ED AELQL
Sbjct: 212 LNSIRQPMVDLLRIAVQARKSILVSGGTGSGKTTLLNALSSYIPSKERLITIEDAAELQL 271

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHV RLETRPPN+EG+GE+  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+
Sbjct: 272 QQPHVGRLETRPPNVEGKGEVRQRELLKNALRMRPDRIIVGEVRGEEAFDMLQAMNTGHE 331

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM TIHAN  R++  R+E M+ M G  + +  +R  I S++D+IVQTQRL DG RR+T+
Sbjct: 332 GSMTTIHANTPRDAISRLEQMVGMAGMPMSNDSIRAQIASAIDIIVQTQRLSDGGRRVTS 391

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           I E+ GMEGNV+  Q++  +        G +IG+  +TGV RPRF   AA  G +
Sbjct: 392 ISELTGMEGNVVQLQEIYHFVRRDVGTDGTIIGEFRATGV-RPRFAQEAATLGHQ 445


>gi|145219380|ref|YP_001130089.1| type II secretion system protein E [Prosthecochloris vibrioformis
           DSM 265]
 gi|145205544|gb|ABP36587.1| type II secretion system protein E [Chlorobium phaeovibrioides DSM
           265]
          Length = 479

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 281/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +Y  K  +   L+  ID+  +     +  R+E+  L++ ++    + ++  E+  L  DL
Sbjct: 60  FYATKKKLHQKLLTRIDLNSIESLSPEQLRNELGILLSRLIEEDALPLNEQERARLVADL 119

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N+I+G GPL+PL+A  +I++IMVNG   V+ E NG    T I F D+  L+ +  +IV+
Sbjct: 120 KNEIMGLGPLEPLLADPNISEIMVNGYRTVYAEKNGCIQLTEIRFNDDAHLIKIIDKIVS 179

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DES P+ DARL DGSRVN IIPPLALDGP LTIR+F    L +D LV    +T 
Sbjct: 180 RVGRRIDESCPMADARLPDGSRVNAIIPPLALDGPVLTIRRFSVVPLKMDDLVKKNTLTT 239

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + + +CN++ISGGTG+GKTTLLN L+ +I  +ER+VT EDTAELQ Q  HV+
Sbjct: 240 SMAELLSALVKGKCNIIISGGTGTGKTTLLNILSGFIPSNERVVTIEDTAELQFQHDHVI 299

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LETRP NIEG+GEITMR LVKN LRMRP+RI+LGEVR  EV+D+LQAMNTGHDGS+ TI
Sbjct: 300 HLETRPQNIEGKGEITMRALVKNALRMRPDRIVLGEVRSSEVIDMLQAMNTGHDGSLTTI 359

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN++R++ GR+E ++ M G +LPS+ +R++ITSS++ I+Q  RL DG+R+IT+I EI G
Sbjct: 360 HANSSRDALGRLENLVGMAGISLPSKALRQLITSSINFIIQVSRLNDGTRKITSIQEITG 419

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG +I TQ++  Y   G    G + G   +TGV RP+   +   YG
Sbjct: 420 MEGEIITTQEIFSYTRTGTKPDGTVEGMFRATGV-RPKVHEKILTYG 465


>gi|13475420|ref|NP_106984.1| secretory protein kinase [Mesorhizobium loti MAFF303099]
 gi|14026172|dbj|BAB52770.1| secretory protein kinase [Mesorhizobium loti MAFF303099]
          Length = 461

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/412 (47%), Positives = 275/412 (66%), Gaps = 4/412 (0%)

Query: 56  PH---YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           PH   +  +K  +   LI+  ++  L         +EI  ++ E V  + + ++  E   
Sbjct: 37  PHGDEFLALKVDLHRHLIDRFNLASLETASKDEILNEIRPIVREFVRGRNVPLNARELDQ 96

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L  D  +++LG GP++PL+  D IADI++N   +VFIE  G   ET I FRD   LL V 
Sbjct: 97  LTSDTADEMLGLGPIEPLLKDDSIADILINTHKRVFIERYGVIEETAIRFRDEAHLLRVI 156

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            +IV+ +GRRVDES P+ DARL DGSRVN+ + P+++DGP ++IRKF K+  +L+ L++F
Sbjct: 157 NKIVSAIGRRVDESVPMVDARLADGSRVNIAVRPISVDGPLVSIRKFSKNPYSLERLMAF 216

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
            ++      LL+I  + R ++L+SGGTGSGKTTLLN L+ YI   ER++T ED AELQLQ
Sbjct: 217 NSIRQPMVDLLRIAVQSRKSILVSGGTGSGKTTLLNALSSYIPSRERLITIEDAAELQLQ 276

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHV RLETRPPN+EG+GE+  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+G
Sbjct: 277 QPHVGRLETRPPNVEGKGEVRQRELLKNALRMRPDRIIVGEVRGEEAFDMLQAMNTGHEG 336

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM TIHAN  R++  R+E M+ M G  + +  +R  I S++D+IVQTQRL DG RR+T+I
Sbjct: 337 SMTTIHANTPRDAISRLEQMVGMAGMPMTNDSIRAQIASAIDIIVQTQRLSDGGRRVTSI 396

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            E+ GMEGNV+  Q++  +        G ++G+  +TGV RPRF   AA  G
Sbjct: 397 SELTGMEGNVVQLQEIYHFVRRDVRADGTIVGEFRATGV-RPRFATEAAAMG 447


>gi|320160791|ref|YP_004174015.1| putative type II/IV secretion system protein [Anaerolinea
           thermophila UNI-1]
 gi|319994644|dbj|BAJ63415.1| putative type II/IV secretion system protein [Anaerolinea
           thermophila UNI-1]
          Length = 439

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/368 (52%), Positives = 267/368 (72%), Gaps = 8/368 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           LF D+ +D+LG+GPLQPL+   DI++IMVNG   V+IE  GK  +T I F ++  ++ + 
Sbjct: 67  LFHDILDDLLGFGPLQPLLDDPDISEIMVNGPKLVYIERKGKLQKTNITFENDAAVIRLI 126

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           ++IV  +GRR+D  SP  DARL DGSRVN +IPP A+DGPT+TIRKF+KDKLT+  L+++
Sbjct: 127 EKIVLPLGRRIDADSPTVDARLPDGSRVNAVIPPCAIDGPTITIRKFQKDKLTIQQLINY 186

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G++T   A  ++     R N++ISGGTGSGKTTLLN L+ +I +DERIVT ED AEL+LQ
Sbjct: 187 GSITENMANFIRACVIARLNIIISGGTGSGKTTLLNILSSFIPEDERIVTIEDAAELKLQ 246

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HVVRLET+PPN EG   +T+RDLV+N LRMRP+RI++GE RG E LD+LQAMNTGHDG
Sbjct: 247 QEHVVRLETKPPNSEGRNAVTIRDLVRNALRMRPDRIVVGECRGGEALDMLQAMNTGHDG 306

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HAN  R++  R+E M  M G  LP +++RE I S++D+I+Q  RL+DGSR++ +I
Sbjct: 307 SLTTLHANTPRDALSRLETMCLMSGMELPVRVIREQIASAIDLIIQVARLKDGSRKVVSI 366

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR--AAQY--GEE-- 466
            E+ GMEG+ I+  D+ K+E  G    GK++G+   TG+ RP F  R  AA +  G E  
Sbjct: 367 TEVAGMEGDTIVMTDIFKFEQTGISTDGKVLGELKPTGI-RPLFTPRLEAAGFKLGPEVF 425

Query: 467 -KNLAEVL 473
             NLA++L
Sbjct: 426 GANLADIL 433


>gi|308050053|ref|YP_003913619.1| type II secretion system protein E [Ferrimonas balearica DSM 9799]
 gi|307632243|gb|ADN76545.1| type II secretion system protein E [Ferrimonas balearica DSM 9799]
          Length = 442

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/410 (49%), Positives = 286/410 (69%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P   EVK  ++  L+ M+D+++L       AR +I  L N+I+S     +SL  +  + 
Sbjct: 17  SPQEEEVKQDLYERLLSMLDVSKLEVIPEPEARQQITRLCNQILSDNPRPLSLVSRDKII 76

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           + + +++LG GPL+PL+A   I+DI++N ++ +F+E  GK     + F D+  L+++  +
Sbjct: 77  KQINDEVLGLGPLEPLLADSTISDILINSASSIFVERFGKLEPVPMRFHDDRHLMNIIDK 136

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+ VGRRVDESSP+ DARL DGSRVN IIPPLALDGP+++IR+F  DKLT + L+ + A
Sbjct: 137 IVSSVGRRVDESSPMVDARLQDGSRVNAIIPPLALDGPSMSIRRFTVDKLTAEQLIDYNA 196

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T E  ++L+ I   + NVLISGGTGSGKTT+LN L+ YI  DERI+T ED+AELQLQQP
Sbjct: 197 ITREMYQVLKAIVEGKLNVLISGGTGSGKTTMLNVLSGYIPSDERIITIEDSAELQLQQP 256

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLE+RP N+EG GE+  R+LVKN LRMRP+RI++GEVRG E LD+L AMNTGH+GS+
Sbjct: 257 HVVRLESRPANLEGRGEVNQRELVKNSLRMRPDRIVIGEVRGAEALDMLTAMNTGHEGSL 316

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T+HAN  R++  R+E M+ M GF +P + +R  I S++ V+VQ +R  DG RR+ +I E
Sbjct: 317 TTLHANTCRDALSRLENMVCMAGFDMPVKNIRTQIASAIHVVVQLERQEDGKRRVVSISE 376

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG VI   DL  +   G D+ G ++G+  +TGV  PRF++     G
Sbjct: 377 ITGMEGEVITLSDLFVFRRRGRDKEGNILGEFQATGVI-PRFYDELVSKG 425


>gi|225872756|ref|YP_002754213.1| type II/IV secretion system protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225792394|gb|ACO32484.1| type II/IV secretion system protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 452

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 286/421 (67%), Gaps = 2/421 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQ-SARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           Y+E+KS +   LI+ +D+ +L     Q + + ++ TL+ +++  + + +S  ++  L ++
Sbjct: 32  YHELKSAVHHELIKRVDLEKLGVLQGQRNGQGQLLTLIQQLIGEQGVPLSAIDRDRLAQE 91

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + +++ G GPL+PL+    + DI+VN    V++E  G    T + F+D   L+ +  +IV
Sbjct: 92  VLDEVFGLGPLEPLLQDPTVNDILVNTHKVVYVERKGVLERTNVVFKDETHLMHIIDKIV 151

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           + VGRRVDESSP+ DARLLDGSRVN++IPPLA+DGP+++IR+F    LT D LV F A+T
Sbjct: 152 SAVGRRVDESSPMVDARLLDGSRVNIVIPPLAIDGPSISIRRFPSSPLTADDLVRFRALT 211

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
                LL+   R R N++++GGTG+GKTTLLN L+ +I + ERIVT ED+AELQL+Q HV
Sbjct: 212 PAMLELLKGAVRARLNIVVAGGTGAGKTTLLNVLSGFISERERIVTIEDSAELQLKQDHV 271

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLE RPPN+EG+G I  R+LV N LRMRP+R++LGE+RG E LD+LQAMNTGHDGS+ T
Sbjct: 272 VRLECRPPNVEGKGAIRQRELVINALRMRPDRVVLGEIRGEEALDMLQAMNTGHDGSITT 331

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+E M  MG  TLP + +R  I S++ +++Q  RL DGSRRIT+I EI 
Sbjct: 332 LHANTPRDAISRLETMCMMGNVTLPEKAIRNQIASAVHILIQAHRLSDGSRRITHISEIT 391

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           G  G+V+  QD+  +E MG    GK+ G+  STG+  P+F  +    G   NL  + Q +
Sbjct: 392 GTSGDVVSMQDIFLFEKMGLGPNGKVKGRFYSTGIV-PKFAEKLKAAGIPFNLNMLDQPV 450

Query: 477 E 477
           E
Sbjct: 451 E 451


>gi|118581110|ref|YP_902360.1| type II secretion system protein E [Pelobacter propionicus DSM
           2379]
 gi|118503820|gb|ABL00303.1| type II secretion system protein E [Pelobacter propionicus DSM
           2379]
          Length = 437

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 291/423 (68%), Gaps = 2/423 (0%)

Query: 42  PSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVK 101
           PS  G I N     P + E+K+ I  TLIE +DI++L Q        EI  ++  +++ +
Sbjct: 7   PSDPGRI-NVSGSVPFFQELKTKIHRTLIERVDISKLEQLRGNDLTREIGYIVESLIAEE 65

Query: 102 KITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGIN 161
            + ++  E+  L  ++ ++  G GPL+PL+A  DI+DI+VN  + +++E  GK  +T I 
Sbjct: 66  GVPLNQQEKERLIIEIQHETFGLGPLEPLLADPDISDILVNSCSNIYVERFGKLHKTDIV 125

Query: 162 FRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKK 221
           FRDN  LL + +RIV++VGRR+DESSP  DARL DGSRVN IIPPLA+DGP L+IR+F  
Sbjct: 126 FRDNAHLLQIIERIVSKVGRRIDESSPYVDARLPDGSRVNAIIPPLAIDGPALSIRRFGV 185

Query: 222 DKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIV 281
           + L +  L+  GA+  +  ++L+   + R N+LISGGTG+GKTTLLN L+  I   ERI+
Sbjct: 186 EPLRIGDLLRLGALDDKMFKILEGAVKTRLNILISGGTGTGKTTLLNVLSENIPSTERII 245

Query: 282 TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLD 341
           + ED+AEL L+Q HVVRLETRPPNIEG GE+T RDLV+N LRMRP+RII+GEVRG E LD
Sbjct: 246 SIEDSAELHLKQEHVVRLETRPPNIEGRGEVTQRDLVRNSLRMRPDRIIIGEVRGGEALD 305

Query: 342 LLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQR 401
           +LQAMNTGHDGS+ TIH+N+ R++  R+E M+ M G  LP + +RE I S+++++VQ  R
Sbjct: 306 MLQAMNTGHDGSLSTIHSNSTRDAMARLETMVLMAGMDLPQKAIREQIASAINIVVQLVR 365

Query: 402 LRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAA 461
             DG+R+I  + EI G+EG+ I+ QD+  ++  G D  G ++G +  TGV RPRF  R  
Sbjct: 366 FADGTRKIVKLTEINGLEGDTIVMQDIFVFDQKGVDSDGNIVGTYRPTGV-RPRFAERFK 424

Query: 462 QYG 464
            YG
Sbjct: 425 VYG 427


>gi|312621084|ref|YP_003993812.1| type ii/iv secretion system ATP hydrolase tada/virb11/cpaf, tada
           subfamily [Photobacterium damselae subsp. damselae]
 gi|311872805|emb|CBX86896.1| Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Photobacterium damselae subsp. damselae]
          Length = 426

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/367 (51%), Positives = 262/367 (71%), Gaps = 1/367 (0%)

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           +  + L +++ G GPLQPL+  + I+DIM+NG + VFIE NG   +  I+F D  QL+ +
Sbjct: 58  EYVKSLVDELQGLGPLQPLMDDESISDIMINGCDHVFIEKNGVVEQANISFIDENQLIHI 117

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RI ++VGRRVDESSP CDARL DGSRVN++IPP+A+DG  ++IRKFKK  + LD L  
Sbjct: 118 AKRIASRVGRRVDESSPTCDARLPDGSRVNIVIPPIAIDGTAISIRKFKKQTIGLDKLTE 177

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FGA++ E A++L I  R R N+LISGGTGSGKTTLLN L+++I + ERIVT ED AEL+L
Sbjct: 178 FGAMSPEMAQVLMIAARCRLNILISGGTGSGKTTLLNALSQFISEKERIVTIEDAAELRL 237

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QPHVVRLETR   IEG G IT RDLV N LRMRP+RI++GE RG E  ++LQAMNTGHD
Sbjct: 238 LQPHVVRLETRTSGIEGTGAITQRDLVINSLRMRPDRIVIGECRGGEAFEMLQAMNTGHD 297

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM T+HAN  R++  R+E+M+ M    LP + +R  I S++D+++Q  RL DGSRRI +
Sbjct: 298 GSMSTLHANTPRDALARVESMVIMATNNLPLEAIRRTIVSAVDIVIQISRLHDGSRRIMS 357

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLA 470
           I E+VG+EG+ ++ +++ K++ +  D +G++ G  I+ G + R     +A  YG ++ L 
Sbjct: 358 ISEVVGLEGSNVVLEEIFKFQTISPDTSGRVRGNFITAGLIQRSVLVEKARFYGLDEQLK 417

Query: 471 EVLQSLE 477
              +S E
Sbjct: 418 AAFKSGE 424


>gi|296134295|ref|YP_003641542.1| type II secretion system protein E [Thermincola sp. JR]
 gi|296032873|gb|ADG83641.1| type II secretion system protein E [Thermincola potens JR]
          Length = 458

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/438 (47%), Positives = 301/438 (68%), Gaps = 8/438 (1%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLS------QYDSQSA 86
           +KQNL     + E      V + P Y E+K  I   +IE +D   L       +   +  
Sbjct: 10  EKQNLNEGPDTQERVFSQPVVKDP-YQELKLKIHKQVIEELDDEILKGDKTDVEISPEKL 68

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           + +I  L+N I+  +   +   ++  +  ++ ++++G GP+ PLI    +++IMVNG ++
Sbjct: 69  KSQIEDLVNPIIDREAGFIPRADRAKIVSEIIDEVIGLGPITPLINDPTVSEIMVNGPHQ 128

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           V++E +GK   T I+FRDN+ ++ + ++IV  +GRR+DESSP+ DARL DGSRVN IIPP
Sbjct: 129 VYVERSGKLQLTDISFRDNDHVMHIIEKIVAPLGRRIDESSPMVDARLPDGSRVNAIIPP 188

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           LAL GPT+TIRKF KD L +D L+ FG +T + A+ L+   + R N+++SGGTGSGKTT 
Sbjct: 189 LALKGPTITIRKFSKDPLQIDDLIRFGTLTPQMAKFLEACVKGRLNIVVSGGTGSGKTTT 248

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I  DERI+TCED AELQL+Q HVV LE+RP NIEG+G +T+RDLVKNCLRMRP
Sbjct: 249 LNVLSSFIPNDERIITCEDAAELQLRQEHVVTLESRPANIEGKGAVTIRDLVKNCLRMRP 308

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RI++GEVR  E LD+LQAMNTGHDGS+ T HAN+ R+   R+E M+ M G  LP + +R
Sbjct: 309 DRIVVGEVRSGEALDMLQAMNTGHDGSLTTGHANSPRDMLSRLETMVLMAGMELPVRAIR 368

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
           E I S++D+IVQ  RL+DGSR+IT+I E++G+EG+ I+ QD+  +E  G D+ G++IGQ 
Sbjct: 369 EQIASAVDMIVQQNRLKDGSRKITHITEVLGLEGDTIVLQDIFVFEQKGVDDRGRIIGQF 428

Query: 447 ISTGVSRPRFWNRAAQYG 464
             TG+ RP+F ++    G
Sbjct: 429 RPTGI-RPKFLSKLEAAG 445


>gi|87199540|ref|YP_496797.1| type II secretion system protein E [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87135221|gb|ABD25963.1| type II secretion system protein E [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 467

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/404 (48%), Positives = 271/404 (67%), Gaps = 1/404 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  I   L++ +++  + +        E++ ++  I++ + I ++  E+ DL ED+ ++
Sbjct: 52  IKVDIHRELLDRVNLAAIEKLSRTDLVRELSDIIGGILTERNIALNRVEREDLVEDIVDE 111

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ++G GPL+PLI  D I+DI+VNG   VF+E  GK       F+D   LL + Q+IV+ VG
Sbjct: 112 LVGLGPLEPLIKDDSISDILVNGYETVFVERGGKLQRVSTRFQDERHLLRIIQKIVSAVG 171

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RRVDESSP  DARL DGSRVN I+ PLA+DG  L+IRKF K  +++  ++  G+++   A
Sbjct: 172 RRVDESSPFVDARLADGSRVNAIVAPLAIDGSLLSIRKFSKKPISMARMIEIGSLSEPMA 231

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
            LL+ +   R N++ISGGTGSGKTT+LN L+ YID  ERIVT ED+AELQLQQ HV RLE
Sbjct: 232 ILLKAVVEGRLNIIISGGTGSGKTTMLNALSSYIDGTERIVTIEDSAELQLQQEHVARLE 291

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPNIEG GE++ RDLVKN LRMRP+RIILGE R  E  D+LQAMNTGHDGSM T+HAN
Sbjct: 292 TRPPNIEGRGEVSQRDLVKNALRMRPDRIILGECRAGEAFDMLQAMNTGHDGSMTTVHAN 351

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++  R+E M+ M G  +  + VR  I S+++V++Q  RL DG R+  +I E+ GMEG
Sbjct: 352 TPRDALTRIEQMVGMSGIDIAPRSVRAQIGSAVNVVIQIGRLSDGRRKTLSISELTGMEG 411

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
             I  Q++ ++   G DE G +IG   +TG+ RPRF  R    G
Sbjct: 412 ETITMQEIFRFNQRGRDELGNVIGHFEATGI-RPRFAARLEASG 454


>gi|254486613|ref|ZP_05099818.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. GAI101]
 gi|214043482|gb|EEB84120.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. GAI101]
          Length = 479

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 296/427 (69%), Gaps = 1/427 (0%)

Query: 38  QSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           ++S P+    +   + R     E+K  +   L++ +++  L     Q  R EI  +  EI
Sbjct: 40  RASQPATVAPLDKDLKRKQRMSEIKLELHRALLDNLNLAALEHATEQDLRQEINEISAEI 99

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           ++ K I ++ ++++ L  +L +++ G GPL+ L+  D + DI+VNG  ++F+E +GK   
Sbjct: 100 LAEKSIVLNREDRVQLNSELYDEVTGLGPLETLLKDDTVNDILVNGPQQIFVERSGKLQL 159

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           T I F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IR
Sbjct: 160 TDITFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAMVPPIAVDGSLVSIR 219

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KFKKDKL +D LV+FGA + E A  LQ     R N+++SGGTGSGKTT LN L+ +ID D
Sbjct: 220 KFKKDKLGIDDLVAFGAFSEEMAAYLQAAVATRLNIIVSGGTGSGKTTTLNALSSFIDND 279

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG 
Sbjct: 280 ERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGE 339

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR  I+S++++IV
Sbjct: 340 EVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLKAVRSQISSAVNLIV 399

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q  RL+DGSRR+T+I EI GMEG+VI  Q+L +Y+ +G     K+IG   +TGV R  F 
Sbjct: 400 QASRLQDGSRRMTSITEITGMEGDVISMQELFRYQRVGLTPENKIIGHFTATGV-RSHFS 458

Query: 458 NRAAQYG 464
            R   +G
Sbjct: 459 ERFKMWG 465


>gi|167589559|ref|ZP_02381947.1| type II secretion system protein E [Burkholderia ubonensis Bu]
          Length = 430

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/421 (47%), Positives = 278/421 (66%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F ++    +++          R  I  +    V  +++ ++  EQ+ +
Sbjct: 14  RSGKFDAIRTAVFASM----NMSAALMKTRDEVRAGIEQVAAHTVEREQLKITAGEQVLI 69

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            + + ND+ G GP++PL+A + + DI+VNG ++V++E  G+   T + FRD+  + SV Q
Sbjct: 70  VDAILNDMFGVGPIEPLLADETVTDILVNGPDQVYVERAGRLELTTLKFRDDAHVTSVAQ 129

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ GP+++IRKF K  +TL  +   G
Sbjct: 130 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPVAMRGPSISIRKFAKRDITLARMAQQG 189

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++    + L+I    R NV+ISGGTGSGKTTLLN L+++I++ ERIVT ED AELQL Q
Sbjct: 190 NISPAMLQALKIACTCRLNVVISGGTGSGKTTLLNALSQHIEEHERIVTIEDAAELQLLQ 249

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G I+ RDLV+N LRMRP+RIILGE+RGPE  D+LQAMNTGHDGS
Sbjct: 250 PHVVSLETRPENTEGLGGISQRDLVRNALRMRPDRIILGEIRGPEAFDVLQAMNTGHDGS 309

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN+ R++  R+E+M+ M    L    +R  I S++ + VQ +R+RDG RR+T I 
Sbjct: 310 MTTIHANSPRDAISRLESMVMMANANLQLLSIRRQIASAVHLFVQVERMRDGVRRVTRIT 369

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EIVGMEG V+ITQDL  +   G D T   +         RP F  RAA YG E  LAEV 
Sbjct: 370 EIVGMEGEVVITQDLFAFRQDG-DATRDAVKGVFEASSLRPAFAARAAYYGVEDVLAEVF 428

Query: 474 Q 474
           +
Sbjct: 429 R 429


>gi|255261397|ref|ZP_05340739.1| type II secretion system protein E [Thalassiobium sp. R2A62]
 gi|255103732|gb|EET46406.1| type II secretion system protein E [Thalassiobium sp. R2A62]
          Length = 482

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 291/425 (68%), Gaps = 1/425 (0%)

Query: 40  SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS 99
           S+P+    +     R     ++K  +   L++ ++++ L        R EI  +  E + 
Sbjct: 45  SAPAQAAPMDKEKKRKERLGDIKLELHKALLDNLNLSALENASENELRQEIQAIATESLE 104

Query: 100 VKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETG 159
              I ++ +E+  L +DL  ++ G GPL+ L+  + + DI+VNG  ++F+E +GK   T 
Sbjct: 105 EMGIVLNREERTALHQDLFFEVTGLGPLETLLKDESVNDILVNGPQQIFVERSGKLELTD 164

Query: 160 INFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKF 219
           + F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKF
Sbjct: 165 VTFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKF 224

Query: 220 KKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDER 279
           KKDKL++D LV+FGA T E A  LQ     R NV++SGGTGSGKTT LN L+ +ID +ER
Sbjct: 225 KKDKLSIDDLVNFGAFTEEMAAYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDNNER 284

Query: 280 IVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEV 339
           I+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV
Sbjct: 285 ILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEV 344

Query: 340 LDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT 399
           +D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR  I+S++++IVQ 
Sbjct: 345 IDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLKAVRSQISSAVNLIVQA 404

Query: 400 QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            RL+DGSRR+T+I EI GMEG+VI  Q++ +Y+ +G     K+IG   +TGV R  F  R
Sbjct: 405 SRLQDGSRRMTSITEITGMEGDVISMQEVFRYQRVGLTPENKIIGHFTATGV-RSHFSER 463

Query: 460 AAQYG 464
              +G
Sbjct: 464 FKMWG 468


>gi|260431087|ref|ZP_05785058.1| type II/IV secretion system protein, TadA subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414915|gb|EEX08174.1| type II/IV secretion system protein, TadA subfamily [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 482

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/441 (46%), Positives = 296/441 (67%), Gaps = 5/441 (1%)

Query: 22  PQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQY 81
           P     SSS    +  Q  +P+    +     R     E+K  +   L+E ++++ L   
Sbjct: 28  PTSAEASSSTAVARKPQIKTPAEVKGMDRERKRKERLGEIKIELHRELLENLNLSALENA 87

Query: 82  DSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMV 141
                R EI+ + +E++  K I ++ +++  L ++L +++ G GPL+ L+  D ++DI+V
Sbjct: 88  SEAELRAEISAIASEVLEAKNIVLNREDRTQLNKELYDEVTGLGPLETLLQDDTVSDILV 147

Query: 142 NGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVN 201
           NG +++F+E  GK   + + F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N
Sbjct: 148 NGPHQIFVERFGKLELSDVTFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFN 207

Query: 202 VIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGS 261
            ++PP+A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R N+++SGGTGS
Sbjct: 208 AMVPPIAVDGSLVSIRKFKKDKLGIDDLVKFGAFTEEMAAYLQAAVSTRLNIIVSGGTGS 267

Query: 262 GKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNC 321
           GKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN 
Sbjct: 268 GKTTTLNALSSFIDDAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNA 327

Query: 322 LRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLP 381
           LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P
Sbjct: 328 LRMRPDRIIVGETRGAEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMP 387

Query: 382 SQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGK 441
            + VR  I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K
Sbjct: 388 IKAVRSQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNK 447

Query: 442 LIGQHISTGV-----SRPRFW 457
           +IG   +TGV      R R W
Sbjct: 448 IIGHFTATGVRSHYSERFRLW 468


>gi|56697922|ref|YP_168293.1| type II/IV secretion system protein [Ruegeria pomeroyi DSS-3]
 gi|56679659|gb|AAV96325.1| type II/IV secretion system protein, TadA subfamily [Ruegeria
           pomeroyi DSS-3]
          Length = 479

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/412 (50%), Positives = 285/412 (69%), Gaps = 1/412 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
            R     E+K  +   L+E ++++ L        R EI  + +E++  K + ++ ++++ 
Sbjct: 56  KRKERLSELKIELHRDLLENLNLSALEHAAEAELRAEITAITSEVLETKGVVLNREDRMQ 115

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L ++L +++ G GPL+ L+  D + DI+VNG  ++F+E  GK   T I F+D   LL + 
Sbjct: 116 LNKELYDEVTGLGPLETLLQDDTVNDILVNGPQQIFVERAGKLQLTDITFKDERHLLRII 175

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV F
Sbjct: 176 DKIVSAVGRRVDESNPYVDARLADGSRFNAMVPPIAVDGSLVSIRKFKKDKLGIDDLVKF 235

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA T E A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQ
Sbjct: 236 GAFTEEMAAYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDNAERILTIEDTAELQLQ 295

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HV R+E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDG
Sbjct: 296 QVHVGRMESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDG 355

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM TIHAN+AR+   R+E MIAM G  +P + VR  I S++++IVQ  RL+DGSRR+T+I
Sbjct: 356 SMTTIHANSARDGVSRLENMIAMAGIEMPIKAVRSQIASAVNLIVQASRLQDGSRRMTSI 415

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            EI GMEG+VI  Q++ +Y+ +G     K+IG   +TGV R  F  R   +G
Sbjct: 416 TEITGMEGDVISMQEIFRYQRVGLTPDNKIIGHFTATGV-RSHFSERFRMWG 466


>gi|260574613|ref|ZP_05842616.1| type II secretion system protein E [Rhodobacter sp. SW2]
 gi|259023030|gb|EEW26323.1| type II secretion system protein E [Rhodobacter sp. SW2]
          Length = 485

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/405 (49%), Positives = 285/405 (70%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +   L+E +++  L      S + EIA +++E +    + ++ D++  L ++L +
Sbjct: 70  ELKVELHKRLLESLNLAALETASEASLKVEIAAIVSEALDEMSVALNKDDRTTLNQELYD 129

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           +++G GPL+PL+  + + DI+VNG N++F+E  GK   T I F+D   LL +  +IV+ V
Sbjct: 130 EVMGLGPLEPLLKDESVNDILVNGPNRIFVERGGKLELTDITFKDERHLLRIIDKIVSAV 189

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKK+KL +  LV FGA T E 
Sbjct: 190 GRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKFKKEKLGIQDLVRFGAFTEEM 249

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R N+++SGGTGSGKTT LN L+ +ID  ER++T EDTAELQLQQ HV R+
Sbjct: 250 AAYLQAAVSTRLNIIVSGGTGSGKTTTLNALSSFIDNSERVLTIEDTAELQLQQVHVGRM 309

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+G +T RD ++N LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 310 ESRPPNVEGKGAVTQRDCLRNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 369

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+AR+   R+E M+AM G  +P + VR  I +++++IVQ  RL+DGSRR+T+I EI GME
Sbjct: 370 NSARDGISRLENMVAMAGIEMPLKAVRSQIAAAVNLIVQASRLQDGSRRMTSITEITGME 429

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G VI  Q++ +YE +G    GK+IG+  +TGV R  F  R   +G
Sbjct: 430 GEVISMQEIFRYERLGMAPDGKIIGRFNATGV-RSHFSERFRSWG 473


>gi|269105134|ref|ZP_06157828.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268160584|gb|EEZ39083.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 426

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/367 (51%), Positives = 261/367 (71%), Gaps = 1/367 (0%)

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           +  + L +++ G GPLQPL+  + I+DIM+NG + VFIE NG   +  I+F D  QL+ +
Sbjct: 58  EYVKSLVDELQGLGPLQPLMDDESISDIMINGCDHVFIEKNGVVEQANISFIDENQLIHI 117

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RI ++VGRRVDESSP CDARL DGSRVN++IPP+A+DG  ++IRKFKK  + LD L  
Sbjct: 118 AKRIASRVGRRVDESSPTCDARLPDGSRVNIVIPPIAIDGTAISIRKFKKQTIGLDKLTE 177

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FGA++ E A++L I  R R N+LISGGTGSGKTTLLN L+++I + ERIVT ED AEL+L
Sbjct: 178 FGAMSPEMAQVLMIAARCRLNILISGGTGSGKTTLLNALSQFISEKERIVTIEDAAELRL 237

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QPHVVRLETR   IEG G IT RDLV N LRMRP+RI++GE RG E  ++LQAMNTGHD
Sbjct: 238 LQPHVVRLETRTSGIEGTGAITQRDLVINSLRMRPDRIVIGECRGGEAFEMLQAMNTGHD 297

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM T+HAN  R++  R+E+M+ M    LP + +R  I S++D+++Q  RL DGSRRI +
Sbjct: 298 GSMSTLHANTPRDALARVESMVIMATNNLPLEAIRRTIVSAVDIVIQISRLHDGSRRIMS 357

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLA 470
           I E+VG+EG+ ++ +++ K++ +  D +G++ G  I+ G + R     +A  YG ++ L 
Sbjct: 358 ISEVVGLEGSNVVLEEIFKFQTISPDTSGRVRGNFITAGLIQRSVLVEKARFYGLDEQLK 417

Query: 471 EVLQSLE 477
               S E
Sbjct: 418 AAFNSGE 424


>gi|294012233|ref|YP_003545693.1| ATPase CpaF [Sphingobium japonicum UT26S]
 gi|292675563|dbj|BAI97081.1| ATPase CpaF [Sphingobium japonicum UT26S]
          Length = 451

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/407 (50%), Positives = 280/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+K  +   LI++I+++ L          E+  +++E ++++K  ++L+E+  L  D+
Sbjct: 31  HTELKVALHQKLIDIINLSALESMSRAQVEAEVGEIVHEQLALQKHALNLEERRRLVSDI 90

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GPL+PL+    I DI+VNG   VF+E NG+ VET   F+D + LL + Q+IV 
Sbjct: 91  LDELLGLGPLEPLLKDHSITDILVNGHKVVFVERNGRLVETATRFKDEKHLLRIIQKIVA 150

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DESSP  DARL DGSRVN ++PPLA+DG  L+IRKF K  +++  L   G+V A
Sbjct: 151 AVGRRIDESSPFVDARLADGSRVNAVVPPLAIDGSLLSIRKFAKVPISMARLTELGSVPA 210

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A++L  +   R NVLISGGTGSGKTTLLN ++  ID+ ERIVT ED+AELQLQQ HV 
Sbjct: 211 PMAQVLSAVVAARRNVLISGGTGSGKTTLLNAMSAAIDEHERIVTIEDSAELQLQQRHVA 270

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG+GE+T RDLVKN LRMRP+RII+GEVR  E  D+LQAMNTGHDGSM T+
Sbjct: 271 RLETRPPNIEGKGEVTQRDLVKNALRMRPDRIIVGEVRAGEAFDMLQAMNTGHDGSMTTV 330

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI M G  +  +  R  I S+L+VIVQ  RL DG RR+ ++ EI G
Sbjct: 331 HANTPRDALSRVEQMIGMSGIDISPRSARAQIASALNVIVQVGRLADGRRRLLSLSEITG 390

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG VI  Q++ ++++ G DE   + G   +TG+ RP+F    A  G
Sbjct: 391 MEGEVITMQEIFRFKMTGRDENNMVRGHFEATGI-RPKFMGELADRG 436


>gi|59711123|ref|YP_203899.1| putative type IV secretion NTPase [Vibrio fischeri ES114]
 gi|59479224|gb|AAW85011.1| putative type IV secretion NTPase [Vibrio fischeri ES114]
          Length = 429

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 290/425 (68%), Gaps = 6/425 (1%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           N    Y ++++ IF  L    +   L++   Q    +++  ++ ++  +++ +SL  + +
Sbjct: 3   NNKALYIQLRTQIFNAL----EPEALNKLTKQELTQQLSNAVDLLIDREQLPVSLIMKNE 58

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
             E L N+++G GPLQ L+  + I DIM+NG   VFIE +G   +  +NF D +QL+ + 
Sbjct: 59  YVESLVNELVGLGPLQNLMDDETITDIMINGHENVFIERDGLVEKVSVNFIDEQQLIDIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDESSP CDARL DGSRVN++IPP+A+DG +++IRKFKK  +    LV F
Sbjct: 119 KRIASRVGRRVDESSPTCDARLEDGSRVNIVIPPIAIDGTSISIRKFKKQSIAFSDLVEF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++ E A++L +  R R N+LISGGTGSGKTT+LN L+++I + ERIVT ED AEL+LQ
Sbjct: 179 GAMSKEMAQILMVASRCRLNILISGGTGSGKTTMLNALSQFISEGERIVTIEDAAELKLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETR   IEG G ++ RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDG
Sbjct: 239 QPHVVRLETRTSGIEGTGVVSQRDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN+ R++  R+EAM+ M    LP + VR  I S++D+++Q  RL DG+R++ +I
Sbjct: 299 SMSTLHANSPRDALSRVEAMVMMATNNLPLEAVRRTIVSAVDIVIQISRLHDGTRKVMSI 358

Query: 413 CEIVGMEGNVIITQDLLKYEVMGE-DETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLA 470
            E+VG+EGN ++ +++  ++   E +E GK+ G + ++G+  R     +A  +G E+ + 
Sbjct: 359 SEVVGLEGNNVVLEEIFAFKPNKEQNEDGKVKGNYFTSGLMQRSVLMEKARFFGMEEKIQ 418

Query: 471 EVLQS 475
              ++
Sbjct: 419 SAFRA 423


>gi|292491525|ref|YP_003526964.1| type II secretion system protein E [Nitrosococcus halophilus Nc4]
 gi|291580120|gb|ADE14577.1| type II secretion system protein E [Nitrosococcus halophilus Nc4]
          Length = 459

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/407 (49%), Positives = 290/407 (71%), Gaps = 1/407 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E K  I   L+++ID++ ++  + + AR +I  ++N ++  + + +    +  L   + +
Sbjct: 42  EWKHHIHQKLLKVIDLSLVTGLEEKQARTQIREVVNRLMIEESVPLPAATRQRLVTQIED 101

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           +ILG GPL+PL+A   ++DI+VNG + V++E +GK   T + FRD+  L ++  RIV+ V
Sbjct: 102 EILGLGPLEPLLADPSVSDILVNGHDSVYVERHGKIKRTEVQFRDDAHLRNIIDRIVSNV 161

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVNVIIPPLA+DGP L+IR+F   + + + L+ +G++TA  
Sbjct: 162 GRRIDESSPMVDARLKDGSRVNVIIPPLAIDGPMLSIRRFSVYRPSTEDLIEYGSITAMI 221

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A ++  I + R NVLISGGTGSGKTTLLN L+ +I  +ERIVT ED+AELQLQQPHVVRL
Sbjct: 222 AEVISAIVKARLNVLISGGTGSGKTTLLNVLSGFIPHNERIVTIEDSAELQLQQPHVVRL 281

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRPPNIE +GE+T RDLV+N LRMRP+RII+GEVRG E LD+LQAMNTGHDGS+ TIHA
Sbjct: 282 ETRPPNIENKGEVTQRDLVRNSLRMRPDRIIVGEVRGAEALDMLQAMNTGHDGSLTTIHA 341

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ R++  R+E M+ M GF LP + +R  + S++ +++Q +R+ DG RR+ ++ EI GME
Sbjct: 342 NSPRDALSRLETMVTMAGFNLPIRAMRAQMASAIHIVIQLERMEDGKRRVVSLQEIQGME 401

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           G+VI   ++ K+   G D  G + G+  STG+  P+F  R  Q G E
Sbjct: 402 GDVITMSEIFKFHRQGIDGDGNVQGRFQSTGLV-PKFHERLRQRGIE 447


>gi|148976304|ref|ZP_01813028.1| putative pilus assembly protein [Vibrionales bacterium SWAT-3]
 gi|145964398|gb|EDK29653.1| putative pilus assembly protein [Vibrionales bacterium SWAT-3]
          Length = 449

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/423 (47%), Positives = 282/423 (66%), Gaps = 1/423 (0%)

Query: 52  VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
           V  TP   E    I   +I+ ID + +    + +    IA L++EIV  K++ +   +  
Sbjct: 24  VTSTPSIREHYHVIHEEVIKAIDPSVVVSLSTSALEARIAELVSEIVVSKQLPLGHGDVT 83

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
              E L ++ LG GPLQPLI    + DIMVNG  +V++E +GK  +T + FR+ EQLL++
Sbjct: 84  HSVEQLLHEFLGLGPLQPLIEDQTVTDIMVNGYREVYVERSGKLQKTTVQFRNEEQLLNL 143

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV++VGRR+DES+P+ DARL DGSRVNV+IPPLALDG  ++IRKF ++KL+L  L  
Sbjct: 144 ARRIVSKVGRRIDESNPLVDARLDDGSRVNVMIPPLALDGTYISIRKFNENKLSLAQLEG 203

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
            GA++    +L+ II R R NVL++GGTG+GKTTLLN ++  I   ERI+T EDTAEL+L
Sbjct: 204 LGAMSKSMVKLIDIIVRSRLNVLVAGGTGAGKTTLLNAMSFSIPPQERIITIEDTAELRL 263

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVVR ETRP N EG   IT R+LV+N LRMRP+RIILGEVRG E  +++QAMNTGHD
Sbjct: 264 QQPHVVRAETRPANAEGLTPITQRELVRNALRMRPDRIILGEVRGDEAFEMMQAMNTGHD 323

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ T+HAN+A ++  RME M+ M   TLP   +R  I  ++DV++Q +R+RDG RRI +
Sbjct: 324 GSLCTLHANSAADALVRMENMLMMSQATLPLFALRRQIADTIDVVIQVERMRDGKRRIVS 383

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAE 471
           I E+ G+E    IT DL  ++ + ED+ G +IG + S     P F  +   +  +K L  
Sbjct: 384 ITEVQGIESEQYITHDLFTFDALSEDQQGNIIGCYKSARCV-PHFNEKVRHHQLDKQLRA 442

Query: 472 VLQ 474
            ++
Sbjct: 443 AME 445


>gi|149909165|ref|ZP_01897822.1| component of type IV pilus [Moritella sp. PE36]
 gi|149807689|gb|EDM67635.1| component of type IV pilus [Moritella sp. PE36]
          Length = 452

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 260/365 (71%), Gaps = 1/365 (0%)

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           EQ  + + L +++LG GPLQ L+   +I DIMVNG  +VF+E  GK     ++FRD E +
Sbjct: 86  EQRQISQRLVDEMLGLGPLQVLMDDPEITDIMVNGHTEVFVEYRGKVKRADVSFRDEEHV 145

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           L++ +RIV+++GRRVDE++P+ DARL +GSRVNV+IPPLAL+G  ++IRKF   K +L+ 
Sbjct: 146 LNLARRIVSRIGRRVDETTPMVDARLPNGSRVNVLIPPLALNGTCISIRKFNDQKHSLEQ 205

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L + GA++ E A +L II R R NVLISGGTG+GKTTLLN L+  I  DERI+T ED AE
Sbjct: 206 LAALGAMSTEMASVLNIIARSRVNVLISGGTGAGKTTLLNALSFGISPDERIITIEDAAE 265

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           L+LQQPHVV +ETRP ++EG   I  R+L++N LRMRP+RIILGEVRG E  D++QAMNT
Sbjct: 266 LKLQQPHVVSIETRPASVEGVAAIGQRELLRNALRMRPDRIILGEVRGAEAFDMMQAMNT 325

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GHDGSM T+HAN+  ++  R+E M+ M    LP   +R  I S+L+VIVQ +R+RDG RR
Sbjct: 326 GHDGSMSTLHANSPHDALIRLENMLLMAEVNLPISALRRQIASTLEVIVQVERMRDGKRR 385

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
           + NI E+VG+EG+  +T DL  ++    D  G L+GQ +ST +  PRF  +A+ Y  E  
Sbjct: 386 VVNITEVVGLEGDQYLTHDLFHFDYQHMDVNGDLVGQFLSTKI-LPRFSEKASYYQLESQ 444

Query: 469 LAEVL 473
           L + L
Sbjct: 445 LKQAL 449


>gi|77919350|ref|YP_357165.1| Flp pilus assembly ATPase CpaF [Pelobacter carbinolicus DSM 2380]
 gi|77545433|gb|ABA88995.1| Flp pilus assembly ATPase CpaF [Pelobacter carbinolicus DSM 2380]
          Length = 451

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/411 (45%), Positives = 282/411 (68%), Gaps = 1/411 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   +YE+K  I    +E  ++  L   D    + EI  +++  +  +++ ++ +E   L
Sbjct: 27  RDALFYEIKHKIHNRFVEEANLAALDDLDQAEVKQEIGKIVDYFLREEQVLLNEEEHNAL 86

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             ++ +++ G GP++P      I+DI+ N    +++E  G   +T   F DN  L+++  
Sbjct: 87  ILEILDELTGLGPIEPFFKDPTISDILCNTYKDIYVERRGLLEKTPARFVDNAHLMNIID 146

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI+++VGRR+DESSP+ DARL DGSRVN IIPPL+LDGP L+IR+F  + L +D L+++ 
Sbjct: 147 RIISRVGRRIDESSPMVDARLADGSRVNAIIPPLSLDGPILSIRRFSVNPLKMDDLINYK 206

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            +T + A LL    + + N++ISGGTG+GKTTLLN L+ +I  +ERI+T ED+AELQLQQ
Sbjct: 207 TLTPDIATLLAGSVKSKLNIMISGGTGAGKTTLLNILSGFIPGNERIITIEDSAELQLQQ 266

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HV+RLETRP +IEG G +T RDLV+N LRMRP+RII+GEVRG E  D+LQAMNTGH+GS
Sbjct: 267 EHVIRLETRPASIEGTGMVTQRDLVRNSLRMRPDRIIVGEVRGSEAFDMLQAMNTGHEGS 326

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + TIH+N+ R+S  R+E+MI M G  LP   +R +++S+LD++VQ  RL DG+R++T+I 
Sbjct: 327 LTTIHSNSPRDSLTRLESMILMTGVNLPEHAMRFMVSSALDMVVQVSRLADGTRKVTSIA 386

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           E+VGMEG VI  QD+  +E  G D  GK++G+  +TG+ RP+F ++    G
Sbjct: 387 EVVGMEGEVITLQDIFVFERQGIDANGKVVGRFHATGI-RPKFADKLEVAG 436


>gi|219849845|ref|YP_002464278.1| type II secretion system protein E [Chloroflexus aggregans DSM
           9485]
 gi|219544104|gb|ACL25842.1| type II secretion system protein E [Chloroflexus aggregans DSM
           9485]
          Length = 487

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/352 (52%), Positives = 256/352 (72%), Gaps = 1/352 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           LF  +C+++ G+GPLQPL+  D I++IMVNG +KV+IE  GK   + + F  +E ++ + 
Sbjct: 118 LFAMVCDELFGFGPLQPLLDDDSISEIMVNGPHKVYIEQKGKLKLSDVRFASDEHVMKII 177

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            RI+  +GRR+D   P+ DARL DGSRVN IIPP A+DG T+TIRKF K+KL ++ L+ F
Sbjct: 178 DRIIRPLGRRIDRKWPMVDARLPDGSRVNAIIPPCAIDGSTITIRKFSKNKLKVEDLIRF 237

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G++TAE A  L+     R N++++GGTGSGKTTLLN L+ +I +DERI+T ED+AELQL 
Sbjct: 238 GSMTAEMAEFLRACVVSRLNIVVAGGTGSGKTTLLNVLSNFIPEDERIITIEDSAELQLA 297

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HVVRLE +PP I+G G +T+RDLV N LRMRPERI++GE RG E LD+LQAMNTGHDG
Sbjct: 298 QDHVVRLEAKPPEIDGSGRVTIRDLVINSLRMRPERIVIGECRGGETLDMLQAMNTGHDG 357

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HAN  R++  RME M  M G  +P +++RE I S++D+IVQ  RL DGSR++  I
Sbjct: 358 SLTTLHANTPRDAIARMETMSLMAGMDMPLRVIREQIASAIDLIVQQTRLEDGSRKVAYI 417

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            E+ GMEG+ ++ QD+ K E++G+   GK++ +   TGV RP+F  R   +G
Sbjct: 418 TEVQGMEGDTVVLQDIFKLEILGKTPEGKIMAELRPTGV-RPKFTPRLEAHG 468


>gi|99082189|ref|YP_614343.1| type II secretion system protein E [Ruegeria sp. TM1040]
 gi|99038469|gb|ABF65081.1| Hypothetical protein MJ0900 [Ruegeria sp. TM1040]
          Length = 485

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 275/378 (72%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EIA + NE++  K I ++ +++  L ++L +++ G GPL+ L+  D ++DI+VNG  +
Sbjct: 93  RSEIAAISNEVLQEKSIVLNREDRQQLMKELYDEVTGLGPLEALLKDDTVSDILVNGPQQ 152

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +FIE  GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 153 IFIERAGKLELSDITFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLQDGSRFNAMVPP 212

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 213 IAVDGSLVSIRKFKKDKLQIDDLVNFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 272

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 273 LNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 332

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 333 DRIIVGETRGAEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 392

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 393 SQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNKIIGHF 452

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  F  R   +G
Sbjct: 453 TATGV-RSHFSERFRLWG 469


>gi|197334713|ref|YP_002155272.1| TadA [Vibrio fischeri MJ11]
 gi|197316203|gb|ACH65650.1| TadA [Vibrio fischeri MJ11]
          Length = 428

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 289/425 (68%), Gaps = 6/425 (1%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           N    Y ++++ IF  L    +   L++   Q    +++  ++ ++  +++ +SL  + +
Sbjct: 3   NNKALYIQLRTQIFNAL----EPEALNKLTKQELTQQLSNAVDLLIDREQLPVSLIMKNE 58

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
             E L N+++G GPLQ L+  + I DIM+NG   VFIE +G   +  +NF D +QL+ + 
Sbjct: 59  YVESLVNELVGLGPLQNLMDDETITDIMINGHENVFIERDGLVEKVSVNFIDEQQLIDIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDESSP CDARL DGSRVN++IPP+A+DG +++IRKFKK  +    LV F
Sbjct: 119 KRIASRVGRRVDESSPTCDARLEDGSRVNIVIPPIAIDGTSISIRKFKKQSIGFSDLVEF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++ E A++L +  R R N+LISGGTGSGKTT+LN L+++I + ERIVT ED AEL+LQ
Sbjct: 179 GAMSKEMAQILMVASRCRLNILISGGTGSGKTTMLNALSQFISEGERIVTIEDAAELKLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETR   IEG G I+ RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDG
Sbjct: 239 QPHVVRLETRTSGIEGTGVISQRDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN+ R++  R+EAM+ M    LP + VR  I S++D+++Q  RL DG+R++ +I
Sbjct: 299 SMSTLHANSPRDALSRVEAMVMMATNNLPLEAVRRTIVSAVDIVIQISRLHDGTRKVMSI 358

Query: 413 CEIVGMEGNVIITQDLLKYEVMGE-DETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLA 470
            E+VG+EGN ++ +++  ++   E +E GK+ G + ++G+  R     +A  +G E  + 
Sbjct: 359 SEVVGLEGNNVVLEEIFAFKPNKEQNEDGKVKGNYFTSGLMQRSVLMEKARFFGMEDKIQ 418

Query: 471 EVLQS 475
              ++
Sbjct: 419 SAFRT 423


>gi|149909544|ref|ZP_01898198.1| putative type IV secretion NTPase [Moritella sp. PE36]
 gi|149807449|gb|EDM67400.1| putative type IV secretion NTPase [Moritella sp. PE36]
          Length = 427

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 285/425 (67%), Gaps = 6/425 (1%)

Query: 51  FVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
            +N    Y ++++ IF  L    +   ++  D +  + ++++ ++ +V    +++    +
Sbjct: 1   MINAKSIYVQIRALIFDAL----EPEAVNSLDREQLKTQLSSAVDLLVERDGLSVPSVMR 56

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
            D  ++L +++LG GPLQ L+  D I+DIM+NG   VFIE  G      INF D EQLL 
Sbjct: 57  DDFVKNLVDELLGLGPLQSLMDDDSISDIMINGHENVFIERAGIVEPASINFIDEEQLLQ 116

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI  +VGRRVD+S P CDARL DGSRVN++IPP+ALDG  ++IRKFKK  +  D LV
Sbjct: 117 IVKRIAARVGRRVDKSQPTCDARLEDGSRVNIVIPPVALDGTCISIRKFKKRSIDFDQLV 176

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
            FGA++ E A++L I  R R N++ISGGTGSGKTT+LN L+++I K+ERI+T ED AEL+
Sbjct: 177 EFGAMSPEMAKMLMIASRCRLNIIISGGTGSGKTTMLNALSQFISKNERIITIEDAAELR 236

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L QPHVVRLET+   IEG GEI  RDLV N LRMRP+RI++GE RGPE  ++LQAMNTGH
Sbjct: 237 LLQPHVVRLETQKAGIEGNGEINQRDLVINSLRMRPDRIVVGECRGPEAFEMLQAMNTGH 296

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSM T+HAN  R++  R+EAM+ M    LP + +R+ I S++D+I+Q  RL DGSR++ 
Sbjct: 297 DGSMSTLHANTPRDAIARIEAMVMMAANNLPLEAIRQTIVSAVDIIIQISRLHDGSRKVM 356

Query: 411 NICEIVGMEGNVIITQDLLKYEVMGEDET-GKLIGQHISTGV-SRPRFWNRAAQYGEEKN 468
           +I E++G+EG  ++ +++ +++   +    GK+ G  I++G+  R     ++  +G E  
Sbjct: 357 SITEVIGVEGRNVVLEEIFRFQSTHDGANKGKVQGNFITSGLMQRSVLVEKSKFFGLENE 416

Query: 469 LAEVL 473
           L  V 
Sbjct: 417 LKAVF 421


>gi|197106491|ref|YP_002131868.1| Flp pilus assembly protein ATPase CpaF [Phenylobacterium zucineum
           HLK1]
 gi|196479911|gb|ACG79439.1| Flp pilus assembly protein ATPase CpaF [Phenylobacterium zucineum
           HLK1]
          Length = 477

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/400 (48%), Positives = 273/400 (68%), Gaps = 1/400 (0%)

Query: 65  IFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGY 124
           + + LI+ +D+ +L + D    R ++   + E    +++ ++  E  +L   + ++++G 
Sbjct: 62  LHSRLIDELDLAKLDKLDEAELRRQVMGQVVEFARAERMALNTAELEELGASIYDEMVGL 121

Query: 125 GPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVD 184
           GP++PL+  + I DI++NG  +V++E  G+   T ++FRDN+ LL + QRIV  VGRR+D
Sbjct: 122 GPIEPLLKDESINDILINGPYQVYVERRGELELTPVHFRDNDHLLRIVQRIVAGVGRRID 181

Query: 185 ESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQ 244
           ES P+ DARL DGSRVN  IPP+A+DG +++IRKF K  LTL+ LV FGA+    A  L 
Sbjct: 182 ESQPMVDARLPDGSRVNAAIPPIAIDGASVSIRKFSKKPLTLEKLVEFGAMPQAVADFLY 241

Query: 245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPP 304
              R R + +ISGGTGSGKTTLLN L+  I + ER++T ED AELQLQQPHVVR+ETRPP
Sbjct: 242 GAVRARVSTVISGGTGSGKTTLLNALSSAISEGERLITIEDAAELQLQQPHVVRMETRPP 301

Query: 305 NIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARE 364
           NIEG+GEI  R+LVKN LRMRP+R+ILGEVR  E  D+LQAMNTGH+GSM TIHANN RE
Sbjct: 302 NIEGKGEIRQRELVKNALRMRPDRVILGEVRSEEAFDMLQAMNTGHEGSMATIHANNPRE 361

Query: 365 SFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVII 424
           +  R+E M+AMGG  +  + +R  I S++ +IVQ  RL DG R++T + EIVGMEGNV+ 
Sbjct: 362 AISRLEQMVAMGGMNISYEAMRGQIASAVGLIVQVMRLADGKRKVTYVTEIVGMEGNVVQ 421

Query: 425 TQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            QD+  +        G + G+  ++G+ RPR  +   + G
Sbjct: 422 MQDIFTFNRTHTAPDGTVHGEFRASGL-RPRCLDEMLRRG 460


>gi|172062962|ref|YP_001810613.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
 gi|171995479|gb|ACB66397.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
          Length = 472

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 269/392 (68%), Gaps = 5/392 (1%)

Query: 87  RDEIATLMNEI----VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVN 142
           RDE+ T + ++    V  +++ ++  EQ+ + + + ND+ G GP++PL+A D ++DI+VN
Sbjct: 81  RDEVRTGIEQVAAHTVERERLKITAGEQVLIVDAILNDMFGVGPIEPLLADDTVSDILVN 140

Query: 143 GSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNV 202
           G ++V++E  G+   T + FRDN  + SV QRI   VGRRVDESSP+ DARL DGSRVNV
Sbjct: 141 GPDQVYVERAGRLELTSLKFRDNAHVTSVAQRIAAAVGRRVDESSPMVDARLADGSRVNV 200

Query: 203 IIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSG 262
           ++PP+A+ G +++IRKF K  +TL  +   G ++    ++L+I    R N++ISGGTGSG
Sbjct: 201 VLPPIAMRGASISIRKFAKRDITLARMAHQGNISHGMLQVLKIACACRLNIVISGGTGSG 260

Query: 263 KTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCL 322
           KTTLLN L+++I++ ERIVT ED AELQL QPHVV LETRP N EG G I+ RDLV+N L
Sbjct: 261 KTTLLNALSQHIEEHERIVTIEDAAELQLLQPHVVSLETRPENTEGLGGISQRDLVRNAL 320

Query: 323 RMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPS 382
           RMRP+RIILGE+RG E  D+LQAMNTGHDGSM TIHAN  R++  R+E+M+ M    L  
Sbjct: 321 RMRPDRIILGEIRGAEAFDVLQAMNTGHDGSMTTIHANTPRDAISRLESMVMMANANLQL 380

Query: 383 QMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKL 442
             +R  I S++ + VQ +R+RDG RR+T I EIVGMEG V+ITQDL  +     D T  +
Sbjct: 381 LSIRRQIASAVHLFVQIERMRDGVRRVTRITEIVGMEGEVVITQDLFTFR-QESDTTRDV 439

Query: 443 IGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           +         RP F  RAA YG E  L+EV +
Sbjct: 440 VKGVFEASSLRPAFAPRAAYYGMEDALSEVFR 471


>gi|260775650|ref|ZP_05884546.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608066|gb|EEX34235.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
          Length = 427

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/423 (47%), Positives = 288/423 (68%), Gaps = 15/423 (3%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSV--KKITMSLDE--QLDL 113
           +  V+  IF  L E   +  LS       +D++A  +++ V+V  +K   S+ E  + D 
Sbjct: 8   FLSVREQIFDAL-EAEAVNSLS-------KDDLAKQLSDAVNVLIEKNGWSVAEIIRADF 59

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            + L +++ G GPLQ LI  D I+D+MVNG ++VFIE  GK   + ++F D  QLL++ +
Sbjct: 60  VKRLVDELRGLGPLQALIDDDSISDVMVNGFDRVFIERGGKIQASTVSFIDETQLLTIAK 119

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RIV+QVGRR+D+SSP CDARL DGSRVNV+IPP+ALDG +++IRKF K  + L  LV FG
Sbjct: 120 RIVSQVGRRIDDSSPTCDARLSDGSRVNVVIPPIALDGTSMSIRKFSKQSVDLSQLVEFG 179

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A+T + A LL I  R R N+LISGGTGSGKTTLLN L++Y D+ ERIVT ED AEL+L Q
Sbjct: 180 AMTPQMANLLIIASRCRLNILISGGTGSGKTTLLNALSQYADETERIVTIEDAAELKLLQ 239

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVRLETR   +EG G +T RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGS
Sbjct: 240 PHVVRLETRVSGVEGTGAVTQRDLVINALRMRPDRIIVGECRGGEAFEMLQAMNTGHDGS 299

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M T+HAN  R++  R+E+M+ M    LP + +R  I S++D+++Q  RL DGSR++T+I 
Sbjct: 300 MSTLHANTPRDALSRVESMVMMANTNLPLEAIRRTIVSAVDIVIQASRLHDGSRKVTSIS 359

Query: 414 EIVGMEGNVIITQDLLKYEVM--GEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLA 470
           E+VG+EG+ ++ +++ +++ +   ++  GK+ G+ I  G + R     +A  +G  + L 
Sbjct: 360 EVVGIEGDNVVIEEIFRFQPLYQSDNSEGKIEGEFIEHGLLQRSVLTEKARFFGLSEQLN 419

Query: 471 EVL 473
            + 
Sbjct: 420 AIF 422


>gi|84687274|ref|ZP_01015154.1| type II/IV secretion system protein, TadA subfamily protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84664707|gb|EAQ11191.1| type II/IV secretion system protein, TadA subfamily protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 494

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 288/411 (70%), Gaps = 1/411 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R     E+K  +   L++ ++++ L     +  R EI ++ +E++S   + ++ +E+  L
Sbjct: 71  RRERLMEIKVELHKQLLDNLNLSALETAPEKELRAEIQSIASEVLSEMNVVLNREERQTL 130

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             +L +++ G GPL+PL+  D I DI+VNG  ++F+E  GK   T + F+D   LL +  
Sbjct: 131 NAELYDEVTGLGPLEPLLKDDTINDILVNGPKQIFVERAGKLSLTDVTFKDERHLLRIID 190

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV FG
Sbjct: 191 KIVSAVGRRVDESNPSVDARLADGSRFNAMVPPIAVDGSLVSIRKFKKDKLAIDDLVQFG 250

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A + E A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ
Sbjct: 251 AFSEEMAAYLQAAVACRLNVIVSGGTGSGKTTTLNALSSFIDDSERILTIEDTAELQLQQ 310

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HV R+E+RP N+EG+G ++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGS
Sbjct: 311 THVGRMESRPANVEGKGAVSQRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGS 370

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN+AR++  R+E M+AM G  +P + +R  I+S+++++VQ  RL+DGSRR+ +I 
Sbjct: 371 MTTIHANSARDAVSRLENMVAMAGIEMPIKAIRSQISSAVNLMVQASRLQDGSRRMVSIT 430

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EI GMEG+VI  Q++ +YE +G    GK+IG+  +TGV R  +  R  Q+G
Sbjct: 431 EITGMEGDVISMQEVFRYERLGLTPEGKIIGRFNATGV-RSHYSERFRQWG 480


>gi|307294430|ref|ZP_07574274.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
 gi|306880581|gb|EFN11798.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
          Length = 451

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 279/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+K  +   L+++I++  L          E+  +++E ++++K  ++L+E+  L  D+
Sbjct: 31  HTELKVALHQKLLDLINLAALETMSRAQVEVEVGEIVHEQLALQKHALNLEERRRLVSDI 90

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GPL+PL+    I DI+VNG   VF+E NG+ VET   F+D + LL + Q+IV 
Sbjct: 91  LDELLGLGPLEPLLKDHSITDILVNGHKIVFVERNGRLVETATRFKDEKHLLRIIQKIVA 150

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DE+SP  DARL DGSRVN ++PPLA+DG  L+IRKF K  +++  L   G+V A
Sbjct: 151 AVGRRIDEASPFVDARLADGSRVNAVVPPLAIDGSLLSIRKFAKVPISMARLTELGSVPA 210

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A++L  +   R NVLISGGTGSGKTTLLN ++  ID+ ERIVT ED+AELQLQQ HV 
Sbjct: 211 PMAQVLSAVVAARRNVLISGGTGSGKTTLLNAMSAAIDEHERIVTIEDSAELQLQQRHVA 270

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG GE+T RDLVKN LRMRP+RII+GEVR  E  D+LQAMNTGHDGSM T+
Sbjct: 271 RLETRPPNIEGRGEVTQRDLVKNALRMRPDRIIVGEVRAGEAFDMLQAMNTGHDGSMTTV 330

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN AR++  R+E MI M G  +  +  R  I S+L+VIVQ  RL DG RR+ ++ EI G
Sbjct: 331 HANTARDALSRVEQMIGMSGIDISPRSARAQIASALNVIVQVGRLADGRRRLLSLSEITG 390

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG VI  Q++ ++++ G DE   + G   +TG+ RP+F    A  G
Sbjct: 391 MEGEVITMQEIFRFKMTGRDENDMVRGHFEATGI-RPKFMGELADRG 436


>gi|260426298|ref|ZP_05780277.1| type II/IV secretion system protein, TadA subfamily [Citreicella
           sp. SE45]
 gi|260420790|gb|EEX14041.1| type II/IV secretion system protein, TadA subfamily [Citreicella
           sp. SE45]
          Length = 477

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/405 (49%), Positives = 289/405 (71%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +   L++ ++++ + Q   +  RDEI  ++ E +  K + ++ +E+  L ++L +
Sbjct: 60  EIKLELHRALLDNLNLSAIDQASERELRDEIGAIVAETLQDKGVVLNREERTTLNQELYD 119

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  D ++DI+VNG +++F+E +GK   + + F+D   L+ +  +IV+ V
Sbjct: 120 EVKGLGPLETLLKDDTVSDILVNGPHQIFVERSGKLSLSDVVFKDERHLMRIIDKIVSAV 179

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D L++FGA T E 
Sbjct: 180 GRRVDESNPYVDARLADGSRFNAMVPPIAVDGSLVSIRKFKKDKLGIDDLINFGAFTEEM 239

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 240 AVYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDDSERILTIEDTAELQLQQTHVGRM 299

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+G +T RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 300 ESRPPNVEGKGAVTPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 359

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           NNAR+   R+E MIAM G  +P + +R  I+S++++IVQ  RL+DGSRR+T+I EI GME
Sbjct: 360 NNARDGISRLENMIAMAGIEMPLKAMRSQISSAVNLIVQASRLQDGSRRMTSITEITGME 419

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G+VI  Q++ +++ +G     K+IG   +TGV R  F  R   +G
Sbjct: 420 GDVISMQEIFRFQRVGLTPDNKIIGHFTATGV-RSHFSERFKMWG 463


>gi|149915639|ref|ZP_01904165.1| type II secretion system protein E [Roseobacter sp. AzwK-3b]
 gi|149810531|gb|EDM70374.1| type II secretion system protein E [Roseobacter sp. AzwK-3b]
          Length = 483

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/405 (49%), Positives = 285/405 (70%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +   L++ ++++ L        R EI+++  E++  + I ++ +++  L ++L +
Sbjct: 66  EIKLDLHRALLDNLNLSALDTATETDLRAEISSIAAEVLEERSIVLNREDRATLTQELYD 125

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  D I DI+VNG +++F+E  GK   + + F+D + LL +  +IV+ V
Sbjct: 126 EVRGLGPLETLLKDDTINDILVNGPHQIFVEREGKLEMSDVTFKDEKHLLRIIDKIVSAV 185

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LVSFGA + E 
Sbjct: 186 GRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKFKKDKLGIDDLVSFGAFSEEM 245

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R N+++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 246 AAYLQAAVATRLNIIVSGGTGSGKTTTLNALSSFIDNSERILTIEDTAELQLQQTHVGRM 305

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 306 ESRPPNVEGKGEVSARDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 365

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           NNAR++  R+E M+AM G  +P + VR  I S++ +IVQ  RL+DGSRR+T+I E+ GME
Sbjct: 366 NNARDAISRLENMVAMAGIEMPLKAVRSQIASAVHLIVQASRLQDGSRRMTSITEVTGME 425

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G VI  Q++ +Y+ +G     K+IG    TGV R  F  R   +G
Sbjct: 426 GEVISMQEIFRYQRVGLTPENKIIGHFTGTGV-RSNFTERFRLWG 469


>gi|115358174|ref|YP_775312.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
 gi|115283462|gb|ABI88978.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
          Length = 472

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/421 (46%), Positives = 278/421 (66%), Gaps = 5/421 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R+  +  +++ +F+++    +++          R  I  +    V  +++ ++  EQ+ +
Sbjct: 56  RSGKFDAIRTAVFSSM----NMSAALMKTRDEVRAGIEQVAAHTVERERLKITAGEQVLI 111

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            + + ND+ G GP++PL+A D ++DI+VNG ++V++E  G+   T + FRDN  + SV Q
Sbjct: 112 VDAILNDMFGVGPIEPLLADDTVSDILVNGPDQVYVERAGRLELTSLKFRDNAHVTSVAQ 171

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           RI   VGRRVDESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G
Sbjct: 172 RIAAAVGRRVDESSPMVDARLADGSRVNVVLPPIAMRGASISIRKFAKRDITLARMAHQG 231

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++    ++L+I    R N++ISGGTGSGKTTLLN L+++I++ ERIVT ED AELQL Q
Sbjct: 232 NISHGMLQVLKIACACRLNIVISGGTGSGKTTLLNALSQHIEEHERIVTIEDAAELQLLQ 291

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVV LETRP N EG G I+ RDLV+N LRMRP+RIILGE+RG E  D+LQAMNTGHDGS
Sbjct: 292 PHVVSLETRPENTEGLGGISQRDLVRNALRMRPDRIILGEIRGAEAFDVLQAMNTGHDGS 351

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHAN  R++  R+E+M+ M    L    +R  I S++ + VQ +R+RDG RR+T I 
Sbjct: 352 MTTIHANTPRDAISRLESMVMMANANLQLLSIRRQIASAVHLFVQIERMRDGVRRVTRIT 411

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           EIVGMEG V+ITQDL  +     D T  ++         RP F  RAA YG E  L+EV 
Sbjct: 412 EIVGMEGEVVITQDLFTFR-QDSDTTRDVVKGVFEASSLRPAFAPRAAYYGMEDALSEVF 470

Query: 474 Q 474
           +
Sbjct: 471 R 471


>gi|218708110|ref|YP_002415731.1| putative bacterial type II secretion system protein E [Vibrio
           splendidus LGP32]
 gi|218321129|emb|CAV17079.1| putative bacterial type II secretion system protein E, TadA, CpaF
           [Vibrio splendidus LGP32]
          Length = 427

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/420 (45%), Positives = 288/420 (68%), Gaps = 5/420 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D + +          ++A+ ++ +VS  ++++S   + +    +
Sbjct: 8   YLQLRKQIFDAL----DASVIESLPRLELEAQLASAVDMLVSRDQLSISSLAKSEYVTSM 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++++G GPLQ L+  D I DIM+NG  +V+IE +G   +  + F D +QLL + +RI +
Sbjct: 64  VHELVGLGPLQVLMDDDSITDIMINGPQQVYIERHGLVEKAPVRFIDEKQLLDIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDESSP CDARL DGSRVN++IPP+ L+G +++IRKF+K  +  + LV FG++T 
Sbjct: 124 RVGRRVDESSPTCDARLDDGSRVNIVIPPITLEGTSISIRKFQKQSIGFEELVEFGSLTP 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A LLQ+  R R N+L+SGGTGSGKTTLLN L+++I + ER VT EDTAEL+LQQ HVV
Sbjct: 184 DMAGLLQLAARCRLNILVSGGTGSGKTTLLNALSQHISEGERTVTIEDTAELRLQQSHVV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETR   IEG G IT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RMETRHEGIEGTGAITARDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E+M+ M    LP + +R  I S++D++VQ  RL DGSR+I NI E+VG
Sbjct: 304 HANTPRDALARVESMVMMATNNLPLEAIRRSIVSAVDLVVQVSRLHDGSRKIMNITEVVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAEVLQSL 476
           +EG+ ++ ++L  ++       G++ G ++++GV +R   + +A  +G E+ L +V++S+
Sbjct: 364 IEGSNVVLEELFSFQTSPHSPDGRIRGSYVTSGVMARSALYEKARFFGVEQKLTQVIESM 423


>gi|303241711|ref|ZP_07328208.1| type II secretion system protein E [Acetivibrio cellulolyticus CD2]
 gi|302590712|gb|EFL60463.1| type II secretion system protein E [Acetivibrio cellulolyticus CD2]
          Length = 452

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/410 (48%), Positives = 291/410 (70%), Gaps = 4/410 (0%)

Query: 58  YYEVKSTIFTTLIEMI---DITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           Y  +K+ I + +IE I    +  L   D +   ++I+ ++  I++ +   ++ +E+  + 
Sbjct: 34  YATIKAKIHSKIIEEIKTDSLKDLGPNDDEVLEEQISAIVENILNEESTYITKNERQKIL 93

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ ++ +G+GP+ PLI    +++IMVNG N+V++E  GK V + + F+D++ ++ V ++
Sbjct: 94  SEVIDETIGFGPINPLIHDPTVSEIMVNGPNQVYVEKKGKLVLSEVKFKDDQHVMHVIEK 153

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV  +GRR+DESSP+ DARL +GSRVNVIIPPLALDGP++TIRKF +   T+  L++FG 
Sbjct: 154 IVAPLGRRIDESSPMVDARLPNGSRVNVIIPPLALDGPSITIRKFSEKPYTVKDLINFGT 213

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T   A  L+     R N+++SGGTGSGKTT LN ++ +I +DERIVT ED AE+QL Q 
Sbjct: 214 MTPNVAMFLKACVEARLNIVVSGGTGSGKTTTLNVISSFIPEDERIVTIEDAAEIQLGQD 273

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HV+RLETRPPNIEG+G IT+RDLV+N LRMRP+RI++GEVR  E LD+LQAMNTGHDGS+
Sbjct: 274 HVLRLETRPPNIEGKGAITIRDLVRNSLRMRPDRIVVGEVRSGEALDMLQAMNTGHDGSL 333

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T HAN  R+   R+E M+ M G  LP + +RE I S++D+IVQ  RL+DGSRRIT+I E
Sbjct: 334 TTGHANTPRDMLARLETMVLMAGMELPVKAIREQIASAVDIIVQQSRLKDGSRRITHISE 393

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + GMEG++I  QD+  Y+  G+DE G++IG  + TG+ +P+F  +  + G
Sbjct: 394 VTGMEGDIITMQDIFIYKQSGKDERGRIIGDIVPTGI-KPKFMEKFEKAG 442


>gi|54309663|ref|YP_130683.1| putative Flp pilus assembly protein [Photobacterium profundum SS9]
 gi|46914101|emb|CAG20881.1| putative Flp pilus assembly protein [Photobacterium profundum SS9]
          Length = 424

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 259/363 (71%), Gaps = 1/363 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L ++L ++++G GPLQPLI  D I DIMVNG+N +F E NGK   + + F +  QLL + 
Sbjct: 59  LVKNLVDELVGLGPLQPLIEDDTITDIMVNGANHIFFERNGKLQHSDVVFINEAQLLEIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRI ++VGRRVDESSP+ DARL DGSRVN++I P+A+DG T++IRKF++ K+ L+ LV+F
Sbjct: 119 QRIASRVGRRVDESSPMVDARLEDGSRVNIVIKPIAIDGTTISIRKFREHKIGLEELVTF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R N+LISGGTGSGKTTLLN L+ +I +DERIVT ED AEL+LQ
Sbjct: 179 GSLSPDMARVLMIAARCRLNILISGGTGSGKTTLLNALSNFISEDERIVTIEDAAELKLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETR  +IE  G I+ R+LV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPHVVRLETRTASIENTGAISQRELVINSLRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ ++VQ  R RDGSR+IT++
Sbjct: 299 SMSTLHANTPRDAISRVESMVMMASLNQPLDAIRRTIVSAVHLVVQVNRQRDGSRKITSL 358

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAE 471
            E+VG+EG  ++ ++L +++ +      K+ G+ ++ G+  R     RA  YG +  L  
Sbjct: 359 SEVVGLEGENVVMEELFRFQTLEGKPNDKVRGEFVTQGIMQRSILMQRATYYGLQDELVA 418

Query: 472 VLQ 474
             +
Sbjct: 419 AFR 421


>gi|159043675|ref|YP_001532469.1| type II secretion system protein E [Dinoroseobacter shibae DFL 12]
 gi|157911435|gb|ABV92868.1| type II secretion system protein E [Dinoroseobacter shibae DFL 12]
          Length = 484

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/405 (49%), Positives = 286/405 (70%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K T+   L+E ++++ L     +  R EIA ++ E ++   + ++ DE+  L+E+L +
Sbjct: 68  ELKVTLHKQLLEELNLSALESASEKELRAEIAQIVTESLATLSVALNKDERRTLYEELYD 127

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+PL+  +D+ DI+VNG ++VFIE  GK   + + FRD + LL +  +IV+ V
Sbjct: 128 EVRGLGPLEPLLKDEDVNDILVNGPHRVFIEKAGKLQLSDVKFRDEKHLLRIIDKIVSAV 187

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDE +P  DARL DGSR N ++ P+A DG  ++IRKFKKDKL +D LV+FGA + E 
Sbjct: 188 GRRVDEQNPYVDARLADGSRFNAMVGPIACDGSLVSIRKFKKDKLGIDELVNFGAFSEEM 247

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 248 AVYLQAAVACRLNVIVSGGTGSGKTTTLNALSSFIDNSERILTIEDTAELQLQQVHVGRM 307

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RP N+EG+G +T RD ++N LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 308 ESRPANVEGKGAVTQRDCLRNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 367

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+AR+   R+E M+AM G  +P + +R  I+S++++IVQ  RL+DGSRR+ +I EI GME
Sbjct: 368 NSARDGVSRLENMVAMAGIEMPIRALRAQISSAVNLIVQASRLQDGSRRMVSITEITGME 427

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G++I  Q++ +Y+  G    GK+ G   +TGV R  +  R  Q+G
Sbjct: 428 GDIISMQEVFRYQRTGLLPDGKIKGHFTATGV-RSHYSERFKQWG 471


>gi|171320621|ref|ZP_02909641.1| type II secretion system protein E [Burkholderia ambifaria MEX-5]
 gi|171094134|gb|EDT39221.1| type II secretion system protein E [Burkholderia ambifaria MEX-5]
          Length = 472

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/471 (43%), Positives = 293/471 (62%), Gaps = 16/471 (3%)

Query: 15  REDNNPLPQEVVVSSSNIQKQNLQSSSPSAE-----------GEIGNFVNRTPHYYEVKS 63
           R+ + P P  VV  ++    +      PSA             +    + R+  +  +++
Sbjct: 6   RKRSTPEPAPVVSPAAPRDDEPAPGPGPSASHTPPPVRGAAAADTQEALIRSGKFDAIRT 65

Query: 64  TIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILG 123
            +F+++    +++          R  I  +    V  +++ ++  EQ+ + + + ND+ G
Sbjct: 66  AVFSSM----NMSAALMKTRDEVRAGIEQVAAHTVERERLKITAGEQVLIVDAILNDMFG 121

Query: 124 YGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRV 183
            GP++PL+A D ++DI+VNG ++V++E  G+   T + FRDN  + SV QRI   VGRRV
Sbjct: 122 VGPIEPLLADDTVSDILVNGPDQVYVERAGRLELTPLKFRDNAHVTSVAQRIAAAVGRRV 181

Query: 184 DESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLL 243
           DESSP+ DARL DGSRVNV++PP+A+ G +++IRKF K  +TL  +   G ++    ++L
Sbjct: 182 DESSPMVDARLADGSRVNVVLPPIAMRGASISIRKFAKRDITLARMAHQGNISHGMLQVL 241

Query: 244 QIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRP 303
           +I    R N++ISGGTGSGKTTLLN L+++I++ ERIVT ED AELQL QPHVV LETRP
Sbjct: 242 KIACACRLNIVISGGTGSGKTTLLNALSQHIEEHERIVTIEDAAELQLLQPHVVSLETRP 301

Query: 304 PNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNAR 363
            N EG G I+ RDLV+N LRMRP+RIILGE+RG E  D+LQAMNTGHDGSM TIHAN  R
Sbjct: 302 ENTEGLGGISQRDLVRNALRMRPDRIILGEIRGAEAFDVLQAMNTGHDGSMTTIHANTPR 361

Query: 364 ESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVI 423
           ++  R+E+M+ M    L    +R  I S++ + VQ +R+RDG RR+T I EIVGMEG V+
Sbjct: 362 DAISRLESMVMMANANLQLLSIRRQIASAVHLFVQVERMRDGVRRVTRITEIVGMEGEVV 421

Query: 424 ITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           ITQDL  +     D T  ++         RP F  RAA YG E  L+EV +
Sbjct: 422 ITQDLFAFR-QESDTTRDVVKGVFEASSLRPAFAPRAAYYGVEDTLSEVFR 471


>gi|300856047|ref|YP_003781031.1| putative type II secretion system protein E [Clostridium
           ljungdahlii DSM 13528]
 gi|300436162|gb|ADK15929.1| putative type II secretion system protein E [Clostridium
           ljungdahlii DSM 13528]
          Length = 442

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 294/409 (71%), Gaps = 4/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDIT--QLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           YYE+K  I   +IE +DI   ++S+++ Q  + +I  ++ + + ++ + M+ + +  + E
Sbjct: 27  YYELKMKIQNRVIEELDIDFDEISEHN-QELKQKIDYIVTKHIEMESLNMTNNHKKKIKE 85

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           +L N+I+G+GP+  L++ + + +IMVNG   V+IE NGK V T   F+D+  +L V ++I
Sbjct: 86  ELLNEIIGFGPITGLLSDNSVTEIMVNGPEHVYIEKNGKLVLTDAKFKDDNHVLHVIKKI 145

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V  +GRR+DESSP+ DARL +GSRVN II PLA+DGP++TIRKF +D   ++ LVSFG +
Sbjct: 146 VAPIGRRIDESSPMVDARLPNGSRVNAIISPLAIDGPSITIRKFAEDPFKVEDLVSFGTM 205

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T   A+L++     R N+++SGGTGSGKTT LN L+ +I ++ERIVT ED AELQL Q H
Sbjct: 206 TQSMAKLIKYCVEGRLNIVVSGGTGSGKTTTLNVLSSFIPENERIVTIEDAAELQLSQEH 265

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRP N+EG+GEIT+RDLV+N LRMRP+RII+GEVR  E LD+LQAMNTGHDGS+ 
Sbjct: 266 VVRLETRPANVEGKGEITIRDLVRNSLRMRPDRIIVGEVRSGEALDMLQAMNTGHDGSLT 325

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T HAN+ R+   R+E M+ M G  LP + +R+ + S++D+IVQ  RL DGSR+IT I E+
Sbjct: 326 TGHANSPRDMLSRIETMVLMSGMNLPIKAIRDQVASAIDIIVQQSRLMDGSRKITYITEV 385

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            GMEG+VII QD+ K+E  G D  GK+ G+ +STG+  P+F  +  + G
Sbjct: 386 QGMEGDVIILQDIFKFEQKGVDNRGKVRGEFVSTGIM-PKFVQKLKEKG 433


>gi|221067368|ref|ZP_03543473.1| type II secretion system protein E [Comamonas testosteroni KF-1]
 gi|220712391|gb|EED67759.1| type II secretion system protein E [Comamonas testosteroni KF-1]
          Length = 473

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/411 (46%), Positives = 283/411 (68%), Gaps = 2/411 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P Y  +++ I   ++E  D+  L    +Q+ + EIA +   ++      ++  E+  L 
Sbjct: 49  SPAYLALRTRIHGKMLERFDLAALESLPTQTLQQEIAGMTERLLEEDAAVVNDLERRLLI 108

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            D+ +++LG+GPL+ L+    ++DI+VN  +++++E  G+   T + F D++ LL +  +
Sbjct: 109 RDIQHEMLGFGPLELLMTDPAVSDILVNRHDQIYVERLGRLELTPVVFADDKHLLRIIDK 168

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS-FG 233
           IV+++GRR+DESSP+ DARL DGSRVN +IPP+ALDGP ++IR+F +  L +++L+    
Sbjct: 169 IVSRIGRRIDESSPMVDARLPDGSRVNAVIPPVALDGPMMSIRRFARIPLRMENLIQDLK 228

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           ++T   A  L+ + + + N++ISGGTG+GKTTLLN L+ YI   ER+VT ED AELQLQQ
Sbjct: 229 SLTPGMALTLEALAKAKVNMIISGGTGAGKTTLLNILSGYIPAVERVVTIEDAAELQLQQ 288

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHVVR+ETRPPNIEG GEIT R LV+N LRMRP+RII+GEVRG E +D+LQAMNTGH+GS
Sbjct: 289 PHVVRMETRPPNIEGRGEITQRSLVRNALRMRPDRIIIGEVRGAEAVDMLQAMNTGHEGS 348

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + TIHAN  R+S  R+E M+ M G  LP Q  R+ I S++ VIVQ  RL DG R+IT+I 
Sbjct: 349 LTTIHANTPRDSLARLENMVGMAGLNLPHQAARQQIASAITVIVQVLRLTDGKRKITSIQ 408

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EI GMEG+V+  Q++  +   G   +G++ G   ++GV RP+F +R   +G
Sbjct: 409 EITGMEGDVVTMQEIFAFTQTGVGASGEVQGYFHASGV-RPKFADRLKGFG 458


>gi|163733539|ref|ZP_02140982.1| type II/IV secretion system protein, putative [Roseobacter
           litoralis Och 149]
 gi|161393327|gb|EDQ17653.1| type II/IV secretion system protein, putative [Roseobacter
           litoralis Och 149]
          Length = 481

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/403 (49%), Positives = 283/403 (70%), Gaps = 5/403 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +   L++ ++++ L     Q  R EI+ + +E +  + I ++ +++  L  +L +
Sbjct: 64  EIKLDLHHVLLDSLNLSALEHATEQDLRQEISAITSEHLQAQSIVLNREDRQTLTSELYD 123

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  D + DI+VNG  ++F+E +GK   T + F+D   LL +  +IV+ V
Sbjct: 124 EVTGLGPLETLLKDDTVNDILVNGPQQIFVERDGKLQLTDVIFKDERHLLRIIDKIVSAV 183

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV FGA T E 
Sbjct: 184 GRRVDESNPYVDARLKDGSRFNAMVPPVAVDGSLVSIRKFKKDKLGIDDLVHFGAFTEEM 243

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R N+++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 244 AAYLQAAVATRLNIIVSGGTGSGKTTTLNALSSFIDNAERILTIEDTAELQLQQTHVGRM 303

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 304 ESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 363

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+AR+   R+E MIAM G  +P + VR  I+S++++IVQ  RL+DGSRR+T+I E+ GME
Sbjct: 364 NSARDGVSRLENMIAMAGIEMPLKAVRSQISSAVNLIVQASRLQDGSRRMTSITEVTGME 423

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGV-----SRPRFW 457
           G VI  Q++ +Y+ +G     K+IG + +TGV      R R W
Sbjct: 424 GEVISMQEIFRYQRVGLTPENKIIGHYTATGVRSAYAERFRMW 466


>gi|86147187|ref|ZP_01065503.1| putative type IV secretion NTPase; TadA-like protein [Vibrio sp.
           MED222]
 gi|85835071|gb|EAQ53213.1| putative type IV secretion NTPase; TadA-like protein [Vibrio sp.
           MED222]
          Length = 427

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/420 (45%), Positives = 288/420 (68%), Gaps = 5/420 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y +++  IF  L    D + +          ++A+ ++ +VS  ++++S   + +    +
Sbjct: 8   YLQLRKQIFDAL----DASVIESLPRLELEAQLASAVDMLVSRDQLSISSLAKSEYVTSM 63

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++++G GPLQ L+  D I DIM+NG  +V+IE +G   +  + F D +QLL + +RI +
Sbjct: 64  VHELVGLGPLQVLMDDDSITDIMINGPQQVYIERHGLVEKAPVRFIDEKQLLDIAKRIAS 123

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDESSP CDARL DGSRVN++IPP+ L+G +++IRKF+K  +  + LV FG++T 
Sbjct: 124 RVGRRVDESSPTCDARLDDGSRVNIVIPPITLEGTSISIRKFQKQSIGFEELVEFGSLTP 183

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A LLQ+  R R N+++SGGTGSGKTTLLN L+++I + ER VT EDTAEL+LQQ HVV
Sbjct: 184 DMAGLLQLAARCRLNIIVSGGTGSGKTTLLNALSQHISEGERTVTIEDTAELRLQQSHVV 243

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETR   IEG G IT RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+
Sbjct: 244 RMETRHEGIEGTGAITARDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMSTL 303

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E+M+ M    LP + +R  I S++D++VQ  RL DGSR+I NI E+VG
Sbjct: 304 HANTPRDALARVESMVMMATNNLPLEAIRRSIVSAVDLVVQVSRLHDGSRKIMNITEVVG 363

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAEVLQSL 476
           +EG+ ++ ++L  ++       G++ G ++++GV +R   + +A  +G E+ L +V++S+
Sbjct: 364 IEGSNVVLEELFSFQTSPHSPDGRIRGSYVTSGVMARSALYEKARFFGVEQKLTQVIESM 423


>gi|294676062|ref|YP_003576677.1| type II secretion system protein E [Rhodobacter capsulatus SB 1003]
 gi|294474882|gb|ADE84270.1| type II secretion system protein E [Rhodobacter capsulatus SB 1003]
          Length = 486

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 275/378 (72%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           + EIA +  E ++   + ++  E+  L ++L ++++G GPL+PL+  + ++DI+VNG N+
Sbjct: 97  KAEIAAISGEAMTEMSVVLNAVERQSLHQELYDEVMGLGPLEPLLKDETVSDILVNGPNQ 156

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +F+E  GK   + + F+D + LL +  +IV+ VGRRVDES+P   ARL DGSR N ++PP
Sbjct: 157 IFVERFGKLQLSDVTFKDEKHLLRIIDKIVSAVGRRVDESNPYVYARLADGSRFNAMVPP 216

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 217 VAVDGSLVSIRKFKKDKLAIDDLVRFGAFTEEMAAYLQAAVATRLNVIVSGGTGSGKTTT 276

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRMRP
Sbjct: 277 LNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGAVTQRDCLRNALRMRP 336

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHANNAR+   R+E M+AM G  +P + VR
Sbjct: 337 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANNARDGISRLENMVAMAGIEMPLKAVR 396

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G    GK+IG+ 
Sbjct: 397 SQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGLAPDGKIIGRF 456

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  + +R  Q+G
Sbjct: 457 TATGV-RSHYSDRFRQWG 473


>gi|254466813|ref|ZP_05080224.1| type II secretion system protein E [Rhodobacterales bacterium Y4I]
 gi|206687721|gb|EDZ48203.1| type II secretion system protein E [Rhodobacterales bacterium Y4I]
          Length = 478

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 275/376 (73%), Gaps = 5/376 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EIAT+  EI++ K I ++ +++  L ++L +++ G GPL+ L+  + I+DI+VNG ++
Sbjct: 86  RSEIATIATEILAEKSIVLNREDRQQLNKELYDEVTGLGPLETLLQDESISDILVNGPHQ 145

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +F+E +GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 146 IFVERSGKLQLSDITFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 205

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 206 IAVDGSLVSIRKFKKDKLGIDDLVQFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 265

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 266 LNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 325

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 326 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 385

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 386 SQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNKIIGHF 445

Query: 447 ISTGV-----SRPRFW 457
            +TGV      R R W
Sbjct: 446 TATGVRSHYSERFRLW 461


>gi|225181996|ref|ZP_03735428.1| type II secretion system protein E [Dethiobacter alkaliphilus AHT
           1]
 gi|225167281|gb|EEG76100.1| type II secretion system protein E [Dethiobacter alkaliphilus AHT
           1]
          Length = 457

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/351 (55%), Positives = 266/351 (75%), Gaps = 1/351 (0%)

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           ++ ++ +G+GP+ PL+  + ++++MVNG N+V++E NGK V T + FR++  +L + ++I
Sbjct: 97  EIVDEAVGFGPIHPLLNDETVSEVMVNGPNQVYVERNGKLVLTDVVFRNDAHVLHIIEKI 156

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V  +GRR+DESSP+ DARL DGSRVN IIPPLAL GP++TIRKF KD LT+D L+ FG +
Sbjct: 157 VAPIGRRIDESSPMVDARLPDGSRVNAIIPPLALCGPSITIRKFAKDPLTVDDLLGFGTL 216

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           + E A  L+   + + NV++SGGTGSGKTT LN L+ +I  DERIVT ED AELQL+Q H
Sbjct: 217 SLEIAAFLEAAVKSKLNVVVSGGTGSGKTTTLNVLSSFIPHDERIVTIEDAAELQLRQDH 276

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VV LETRPPN+EG+G +T+RDLVKN LRMRPERI++GEVR  E LD+LQAMNTGHDGS+ 
Sbjct: 277 VVSLETRPPNVEGKGSVTIRDLVKNSLRMRPERIVVGEVRSGEALDMLQAMNTGHDGSLT 336

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T HAN+ R+   R+E M+ M G  LP + +RE I+S++DVIVQ  RLRDGSR+IT++ E+
Sbjct: 337 TGHANSPRDMLSRLETMVLMAGMDLPVRAIREQISSAIDVIVQQSRLRDGSRKITHVTEV 396

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
            GMEG++I+ QDL ++E  G DE GK+IG   STG+ RP+F  +    G E
Sbjct: 397 QGMEGDIIVMQDLFRFEQTGIDEEGKIIGSFRSTGI-RPKFIKQLEASGIE 446


>gi|332798623|ref|YP_004460122.1| type II secretion system protein E [Tepidanaerobacter sp. Re1]
 gi|332696358|gb|AEE90815.1| type II secretion system protein E [Tepidanaerobacter sp. Re1]
          Length = 454

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 277/394 (70%), Gaps = 8/394 (2%)

Query: 66  FTTLIEMIDITQLSQYDSQSA--------RDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           F +L E++    + +Y+ Q A          +I  +++  +S +  +++  E+  + +++
Sbjct: 38  FASLREVVHREVIDEYNRQFADGIEHTSDSADIMDIIHRSISRQGQSLTRAEEAKVAQEV 97

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++++G GPL+PL+  + I++IMVNG+N+++IE  G+   TG  FRD+  +L V  RIV+
Sbjct: 98  FDEVMGLGPLEPLLRDETISEIMVNGANQIYIERAGRLQLTGTRFRDDSHVLKVINRIVS 157

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRR DES+P+ DARL DGSR+N +IPP+A+ GP++TIRKF    L +  L+ F +++ 
Sbjct: 158 PLGRRCDESNPMVDARLSDGSRINAVIPPIAIHGPSITIRKFSSTPLKIGDLIGFNSLSQ 217

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A  L+   + RCNV++SGGTGSGKTTLLN L+ YI  +ERIVT ED AELQL Q HVV
Sbjct: 218 AMAHFLEASVKGRCNVVVSGGTGSGKTTLLNVLSGYILDEERIVTIEDVAELQLAQNHVV 277

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE RP NIEG+G +T+RDLV+N LRMRP+RII+GEVR  E LD+LQAMNTGH+GS+ T+
Sbjct: 278 SLEARPSNIEGKGAVTIRDLVRNALRMRPDRIIVGEVRSAEALDMLQAMNTGHEGSLTTV 337

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R+   R+E M+ M G  LP++ +RE I S++D+IV   R RDGSR+I NI E++G
Sbjct: 338 HANSPRDVISRLETMVMMSGMELPAKAIREQIASAVDLIVHQARFRDGSRKIINISEVIG 397

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           MEG++I  QD+  Y   G D++G++ G+ ++TG+
Sbjct: 398 MEGDMITMQDVFVYHPQGYDDSGRISGKFVATGI 431


>gi|77462450|ref|YP_351954.1| putative Flp pilus assembly protein ATPase CpaF [Rhodobacter
           sphaeroides 2.4.1]
 gi|77386868|gb|ABA78053.1| Putative Flp pilus assembly protein ATPase CpaF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 485

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 275/380 (72%), Gaps = 1/380 (0%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           S R EIA +  E +    + ++ DE+  L ++L ++++G GPL+PL+  + I DI+VNG 
Sbjct: 95  SLRSEIAAICGEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGP 154

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
            ++F+E +GK   T   F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++
Sbjct: 155 YRIFVERSGKLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMV 214

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PP+A+DG  ++IRKFKKDKL +  LV FGA T E A  LQ     R N+++SGGTGSGKT
Sbjct: 215 PPIAVDGSLVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKT 274

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRM
Sbjct: 275 TTLNALSSFIDNSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRM 334

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E M+AM G  +P + 
Sbjct: 335 RPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKA 394

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           VR  I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G + +GK+IG
Sbjct: 395 VRAQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIG 454

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TGV R  + +R  Q+G
Sbjct: 455 RFNATGV-RSHYSDRFRQWG 473


>gi|114764949|ref|ZP_01444122.1| type II/IV secretion system protein, TadA subfamily [Pelagibaca
           bermudensis HTCC2601]
 gi|114542661|gb|EAU45685.1| type II/IV secretion system protein, TadA subfamily [Roseovarius
           sp. HTCC2601]
          Length = 489

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/405 (49%), Positives = 288/405 (71%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           ++K  +   L++ +++  + Q   +  R+EI+ ++ E +  K I ++ +++  L ++L +
Sbjct: 72  DIKLEMHRVLLDNLNLAAIDQASEKELREEISAIVAETLQDKGIVLNREDRQTLNQELYD 131

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  + ++DI+VNG +++F+E NGK   + + F+D   L+ +  +IV+ V
Sbjct: 132 EVKGLGPLESLLQDETVSDILVNGPHQIFVERNGKLQVSDVVFKDERHLMRIIDKIVSAV 191

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL++D L+ FGA T E 
Sbjct: 192 GRRVDESNPYVDARLADGSRFNAMVPPIAVDGSLVSIRKFKKDKLSIDDLIQFGAFTEEM 251

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 252 AVYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDDSERILTIEDTAELQLQQSHVGRM 311

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+G +T RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 312 ESRPPNVEGKGAVTPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 371

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           NN R+   RME MIAM G  +P + +R  I+S++++IVQ  RL+DGSRR+T+I EI GME
Sbjct: 372 NNPRDGISRMENMIAMSGVEMPLKAMRSQISSAVNLIVQASRLQDGSRRMTSITEITGME 431

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G+VI  Q++ +Y+ +G     K+IG   +TGV R  F  R   +G
Sbjct: 432 GDVISMQEIFRYQRVGLTPDNKIIGHFTATGV-RSHFSERFKMWG 475


>gi|163847965|ref|YP_001636009.1| type II secretion system protein E [Chloroflexus aurantiacus
           J-10-fl]
 gi|222525845|ref|YP_002570316.1| type II secretion system protein E [Chloroflexus sp. Y-400-fl]
 gi|163669254|gb|ABY35620.1| type II secretion system protein E [Chloroflexus aurantiacus
           J-10-fl]
 gi|222449724|gb|ACM53990.1| type II secretion system protein E [Chloroflexus sp. Y-400-fl]
          Length = 487

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/352 (52%), Positives = 254/352 (72%), Gaps = 1/352 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           LF  +C+++ G+GPLQ L+  D I+++MVNG  KV+IE  GK   + + F  +E ++ + 
Sbjct: 118 LFAMVCDELFGFGPLQQLLDDDSISEVMVNGPYKVYIEQKGKLKLSDVRFASDEHVMKII 177

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            RI+  +GRR+D   P+ DARL DGSRVN IIPP A+DG T+TIRKF K+KL +D L+ F
Sbjct: 178 DRIIRPLGRRIDRKWPMVDARLPDGSRVNAIIPPCAIDGSTITIRKFSKNKLKVDDLIRF 237

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G++TAE A  L+     R N++++GGTGSGKTTLLN L+ +I +DERIVT ED+AELQL 
Sbjct: 238 GSMTAEMAEFLRACVVSRLNIVVAGGTGSGKTTLLNVLSNFIPEDERIVTIEDSAELQLA 297

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HVVRLE +PP I+G G +T+RDLV N LRMRPERI++GE RG E LD+LQAMNTGHDG
Sbjct: 298 QDHVVRLEAKPPEIDGTGRVTIRDLVINSLRMRPERIVIGECRGGETLDMLQAMNTGHDG 357

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HAN  R++  RME M  M G  +P +++RE I S++D+IVQ  RL DGSR++  I
Sbjct: 358 SLTTLHANTPRDAIARMETMALMAGMEMPLKVIREQIASAIDLIVQQTRLEDGSRKVAYI 417

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            E+ GMEG+ ++ QD+ K E++G+   GK++ +   TGV RP+F  R   +G
Sbjct: 418 TEVQGMEGDTVVLQDIFKLEILGKTGEGKILAELRPTGV-RPKFTPRLEAHG 468


>gi|221638313|ref|YP_002524575.1| Type II secretion system protein E [Rhodobacter sphaeroides KD131]
 gi|221159094|gb|ACM00074.1| Type II secretion system protein E precursor [Rhodobacter
           sphaeroides KD131]
          Length = 485

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 275/380 (72%), Gaps = 1/380 (0%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           S R EIA +  E +    + ++ DE+  L ++L ++++G GPL+PL+  + I DI+VNG 
Sbjct: 95  SLRSEIAAICGEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGP 154

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
            ++F+E +GK   T   F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++
Sbjct: 155 YRIFVERSGKLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMV 214

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PP+A+DG  ++IRKFKKDKL +  LV FGA T E A  LQ     R N+++SGGTGSGKT
Sbjct: 215 PPIAVDGSLVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKT 274

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRM
Sbjct: 275 TTLNALSSFIDNSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRM 334

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E M+AM G  +P + 
Sbjct: 335 RPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKA 394

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           VR  I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G + +GK+IG
Sbjct: 395 VRAQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIG 454

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TGV R  + +R  Q+G
Sbjct: 455 RFNATGV-RSHYSDRFRQWG 473


>gi|149200850|ref|ZP_01877825.1| type II/IV secretion system protein, TadA subfamily [Roseovarius
           sp. TM1035]
 gi|149145183|gb|EDM33209.1| type II/IV secretion system protein, TadA subfamily [Roseovarius
           sp. TM1035]
          Length = 481

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/403 (49%), Positives = 283/403 (70%), Gaps = 5/403 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +   +++ +++  L        R EI+++  EI+  K I ++ ++++ L ++L +
Sbjct: 64  EIKIELHRAMLDHLNLAALDSATESDLRSEISSIAGEILEEKGIVLNREDRMQLTQELYD 123

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  D + DI+VNG +++FIE  GK   + + F+D + LL +  +IV+ V
Sbjct: 124 EVKGLGPLETLLKDDTVNDILVNGPHQIFIERAGKLELSDVTFKDEKHLLRIIDKIVSAV 183

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV FGA + E 
Sbjct: 184 GRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKFKKDKLGIDDLVKFGAFSEEM 243

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R NV++SGGTGSGKTT LN L+ +I  DERI+T EDTAELQLQQ HV R+
Sbjct: 244 AAYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIANDERILTIEDTAELQLQQIHVGRM 303

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 304 ESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 363

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           NN R+   R+E M+AM G  +P + VR  I S++++IVQ  RL+DGSRR+T+I EI GME
Sbjct: 364 NNPRDGISRLENMVAMAGLEMPLKAVRSQIASAVNLIVQASRLQDGSRRMTSITEITGME 423

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGV-----SRPRFW 457
           G+VI  Q++ +++ +G     K+IG   +TGV      R R W
Sbjct: 424 GDVISMQEIFRFQRVGLTPDNKIIGHFTATGVRSHYSERFRLW 466


>gi|170704074|ref|ZP_02894706.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
 gi|170131016|gb|EDS99711.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
          Length = 402

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 268/392 (68%), Gaps = 5/392 (1%)

Query: 87  RDEIATLMNEI----VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVN 142
           RDE+   + ++    V  +++ ++  EQ+ + + + ND+ G GP++PL+A D ++DI+VN
Sbjct: 11  RDEVRAGIEQVAAHTVERERLKITAGEQVLIVDAILNDMFGVGPIEPLLADDTVSDILVN 70

Query: 143 GSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNV 202
           G ++V++E  G+   T + FRDN  + SV QRI   VGRRVDESSP+ DARL DGSRVNV
Sbjct: 71  GPDQVYVERAGRLELTPLKFRDNAHVTSVAQRIAAAVGRRVDESSPMVDARLADGSRVNV 130

Query: 203 IIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSG 262
           ++PP+A+ G +++IRKF K  +TL  +   G ++    ++L+I    R N++ISGGTGSG
Sbjct: 131 VLPPIAMRGASISIRKFAKRDITLARMAHQGNISHGMLQVLKIACACRLNIVISGGTGSG 190

Query: 263 KTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCL 322
           KTTLLN L+++I++ ERIVT ED AELQL QPHVV LETRP N EG G I+ RDLV+N L
Sbjct: 191 KTTLLNALSQHIEEHERIVTIEDAAELQLLQPHVVSLETRPENTEGLGGISQRDLVRNAL 250

Query: 323 RMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPS 382
           RMRP+RIILGE+RG E  D+LQAMNTGHDGSM TIHAN  R++  R+E+M+ M    L  
Sbjct: 251 RMRPDRIILGEIRGAEAFDVLQAMNTGHDGSMTTIHANTPRDAISRLESMVMMANANLQL 310

Query: 383 QMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKL 442
             +R  I S++ + VQ +R+RDG RR+T I EIVGMEG V+ITQDL  +     D T  +
Sbjct: 311 LSIRRQIASAVHLFVQIERMRDGVRRVTRITEIVGMEGEVVITQDLFTFR-QESDTTRDV 369

Query: 443 IGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           +         RP F  RAA YG E  L+EV +
Sbjct: 370 VKGVFEASSLRPAFAPRAAYYGMEDTLSEVFR 401


>gi|312883757|ref|ZP_07743476.1| Flp pilus assembly protein TadA [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368506|gb|EFP96039.1| Flp pilus assembly protein TadA [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 445

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/406 (48%), Positives = 279/406 (68%), Gaps = 4/406 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +Y+V   I   +I+ I+ + +    S      I  L+++IVS +++ +   E   + + L
Sbjct: 30  HYQV---IHAKVIKAIEPSVVVNLSSAELEGRIHHLVSDIVSAEQLPLGHREVFTVVKHL 86

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQPLI    + DIMVNG  +V++E  GK  +T + FR  EQLL++ +RIV+
Sbjct: 87  VDEMCGLGPLQPLINDPLVTDIMVNGYKEVYVEKLGKLHKTDVVFRSEEQLLNLARRIVS 146

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRR+DE+SP+ DARL DGSRVNV+IPPLALDG  ++IRKF +DKL+L+ L + G+++ 
Sbjct: 147 KIGRRIDETSPLVDARLQDGSRVNVMIPPLALDGTYISIRKFSQDKLSLNQLATNGSMSI 206

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
              +LL +I R R NVL++GGTG+GKTTLLN ++  I   ERIVT ED AEL+LQQPHVV
Sbjct: 207 NMVQLLDVIVRSRLNVLVAGGTGAGKTTLLNAMSFSIPPTERIVTIEDAAELKLQQPHVV 266

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R ETRP N EG   I  R+LVKN LRMRP+RIILGEVRG E  +++QAMNTGHDGS+ T+
Sbjct: 267 RAETRPANAEGLPAIGQRELVKNSLRMRPDRIILGEVRGEEAFEMMQAMNTGHDGSLSTL 326

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+  ++  R+E M+ M    LP   +R  +  ++DV+VQ +R+RDG RR+  I EI+G
Sbjct: 327 HANSPTDALVRLENMLMMAQSNLPLFALRRQVADTIDVVVQVERMRDGKRRVVAITEIIG 386

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
           +EG   +TQDL +Y + GED  G L G + S+  + P+F  +AA Y
Sbjct: 387 LEGEQYVTQDLYRYVIHGEDVQGNLQGVYQSSR-TLPKFVTKAAYY 431


>gi|332560334|ref|ZP_08414656.1| type II secretion system protein E [Rhodobacter sphaeroides WS8N]
 gi|332278046|gb|EGJ23361.1| type II secretion system protein E [Rhodobacter sphaeroides WS8N]
          Length = 485

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 275/380 (72%), Gaps = 1/380 (0%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           S R EIA +  E +    + ++ DE+  L ++L ++++G GPL+PL+  + I DI+VNG 
Sbjct: 95  SLRSEIAAICGEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGP 154

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
            ++F+E +GK   T   F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++
Sbjct: 155 YRIFVERSGKLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMV 214

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PP+A+DG  ++IRKFKKDKL +  LV FGA T E A  LQ     R N+++SGGTGSGKT
Sbjct: 215 PPIAVDGSLVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKT 274

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRM
Sbjct: 275 TTLNALSSFIDDSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRM 334

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E M+AM G  +P + 
Sbjct: 335 RPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKA 394

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           VR  I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G + +GK+IG
Sbjct: 395 VRAQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIG 454

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TGV R  + +R  Q+G
Sbjct: 455 RFNATGV-RSHYSDRFRQWG 473


>gi|90412173|ref|ZP_01220179.1| putative Flp pilus assembly protein [Photobacterium profundum 3TCK]
 gi|90326897|gb|EAS43282.1| putative Flp pilus assembly protein [Photobacterium profundum 3TCK]
          Length = 424

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/366 (51%), Positives = 259/366 (70%), Gaps = 7/366 (1%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L ++L ++++G GPLQPLI  D I DIMVNG+N +F E NGK   + + F +  QLL + 
Sbjct: 59  LVKNLVDELIGLGPLQPLIEDDTITDIMVNGANHIFFERNGKLQHSDVVFVNEAQLLEIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRI ++VGRRVDESSP+ DARL DGSRVN++I P+A+DG T++IRKF++ K+ L+ LV+F
Sbjct: 119 QRIASRVGRRVDESSPMVDARLEDGSRVNIVIKPIAIDGTTISIRKFREHKIGLEELVTF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R N+LISGGTGSGKTTLLN L+ +I +DERIVT ED AEL+LQ
Sbjct: 179 GSLSPDMARVLMIAARCRLNILISGGTGSGKTTLLNALSNFISEDERIVTIEDAAELKLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETR  +IE  G ++ R+LV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPHVVRLETRTASIENTGAVSQRELVINSLRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ ++VQ  R RDGSR+IT++
Sbjct: 299 SMSTLHANTPRDAISRVESMVMMASLNQPLDAIRRTIISAVHLVVQVNRQRDGSRKITSL 358

Query: 413 CEIVGMEGNVIITQDLLKYEVM----GEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
            EIVG+EG  ++ ++L +++       E+  GK + Q I   + R     RAA YG +  
Sbjct: 359 SEIVGLEGENVVMEELFRFQASEGKPNENVRGKFVTQGI---MQRSILMQRAAYYGLQDE 415

Query: 469 LAEVLQ 474
           L    +
Sbjct: 416 LVAAFR 421


>gi|126461328|ref|YP_001042442.1| type II secretion system protein E [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102992|gb|ABN75670.1| type II secretion system protein E [Rhodobacter sphaeroides ATCC
           17029]
          Length = 485

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 274/380 (72%), Gaps = 1/380 (0%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           S R EIA +  E +    + ++ DE+  L ++L ++++G GPL+PL+  + I DI+VNG 
Sbjct: 95  SLRSEIAAICGEALEEMSVVLNKDERAILNQELYDEVMGLGPLEPLLKDETINDILVNGP 154

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
            ++F+E  GK   T   F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++
Sbjct: 155 YRIFVERGGKLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMV 214

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PP+A+DG  ++IRKFKKDKL +  LV FGA T E A  LQ     R N+++SGGTGSGKT
Sbjct: 215 PPIAVDGSLVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKT 274

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRM
Sbjct: 275 TTLNALSSFIDDSERILTIEDTAELQLQQAHVGRMESRPPNVEGKGAVTQRDCLRNALRM 334

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E M+AM G  +P + 
Sbjct: 335 RPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKA 394

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           VR  I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G + +GK+IG
Sbjct: 395 VRAQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIIG 454

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TGV R  + +R  Q+G
Sbjct: 455 RFNATGV-RSHYSDRFRQWG 473


>gi|281356956|ref|ZP_06243446.1| FHA domain containing protein [Victivallis vadensis ATCC BAA-548]
 gi|281316514|gb|EFB00538.1| FHA domain containing protein [Victivallis vadensis ATCC BAA-548]
          Length = 568

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 273/405 (67%), Gaps = 4/405 (0%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLS--QYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           P   E+K      L+  +++ +L+         +++ A ++ EI+S   +T+  +  L +
Sbjct: 145 PILQEIKKHAHRELLIRLNLKKLAVAGVSGDELKEQAAVMVREILSQLTVTLPPELPLSV 204

Query: 114 FE-DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
            E +L  + +G GPL+ LI RDDI +IMVNG ++VF+E  G    T   F DN Q+LS  
Sbjct: 205 LERELIQEAVGLGPLEYLIERDDITEIMVNGPDQVFVEKEGVLYRTDTAFADNNQVLSAI 264

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RIV  +GRR+DESSP+ DARL DGSRVN IIPPL+L GPT+TIRKF +       L+ F
Sbjct: 265 ERIVAPLGRRIDESSPMVDARLPDGSRVNAIIPPLSLVGPTITIRKFSRKPFEAADLIRF 324

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+V+A+  + L +   +R N+LISGGTGSGKTTLLN L+ ++   ERIVT ED AELQL 
Sbjct: 325 GSVSADIMQFLAVCVAVRKNILISGGTGSGKTTLLNVLSSFLPNRERIVTIEDAAELQLH 384

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q H+VRLE+RPPNIEG+G +T+RDLV+N LRMRP+RI++GE RG E LD+LQAMNTGHDG
Sbjct: 385 QEHLVRLESRPPNIEGKGAVTIRDLVRNSLRMRPDRIVVGECRGGEALDMLQAMNTGHDG 444

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ TIHAN+ R++  R+E ++ M GF LP + +RE + S++ ++VQ  R RDGSR+I N+
Sbjct: 445 SLTTIHANSPRDALSRLETLVLMAGFDLPLRAIREQVASAIHIVVQITRERDGSRKIVNV 504

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
            EI  MEG+VI  QDL  +   G D   ++ G    TG S P F 
Sbjct: 505 SEITKMEGDVITMQDLFVFRQTGWDGENRITGVFEPTG-SVPTFM 548


>gi|325964116|ref|YP_004242022.1| Flp pilus assembly protein, ATPase CpaF [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323470203|gb|ADX73888.1| Flp pilus assembly protein, ATPase CpaF [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 487

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/381 (50%), Positives = 285/381 (74%), Gaps = 6/381 (1%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           SA DE++T+++E    +++ +S +E+  L  ++ ++++GYGPLQ L+    I +IMVN  
Sbjct: 94  SAVDELSTVIDE----EQVPLSPEERRRLIREIADEVMGYGPLQRLLEDPSITEIMVNRF 149

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
           ++++IE +G    TG  F  ++ L +V +RIV++VGRR+DESSP+ DARL DGSRVN II
Sbjct: 150 DQIYIERHGHLTLTGTRFSSDDHLRTVIERIVSRVGRRIDESSPLVDARLEDGSRVNAII 209

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PPLA++GP+LTIRKF    LT+ +L+ +G++T E A LL    R R N+++SGGTG+GKT
Sbjct: 210 PPLAVNGPSLTIRKFSHVPLTVQNLIDWGSLTPEMAELLNACVRARLNIIVSGGTGTGKT 269

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           TLLN L+ +I  D+RIVT ED  ELQLQQ HVVRLE+RPPNIEG+G +T+R+LV+N LRM
Sbjct: 270 TLLNVLSSFIPPDDRIVTIEDAVELQLQQEHVVRLESRPPNIEGKGAVTIRELVRNSLRM 329

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GEVR  E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E ++ M G  LP + 
Sbjct: 330 RPDRIIVGEVRSGESLDMLQAMNTGHDGSLSTVHANSPRDAIARLETLVLMAGMDLPLRA 389

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE-VMGEDETGKLI 443
           +RE ++S++D+I+Q  RLRDG+RR+T++ E+ GMEG+++  QD   ++   G D  G+ +
Sbjct: 390 IREQVSSAVDLIIQVTRLRDGTRRVTHVTEVQGMEGDIVTLQDAFLFDYAAGMDAHGRFL 449

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G+ ++TG+ RPRF +R A+ G
Sbjct: 450 GKPVATGI-RPRFLDRFAELG 469


>gi|259417843|ref|ZP_05741762.1| type II secretion system protein E [Silicibacter sp. TrichCH4B]
 gi|259346749|gb|EEW58563.1| type II secretion system protein E [Silicibacter sp. TrichCH4B]
          Length = 483

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/378 (52%), Positives = 275/378 (72%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EIA++  E++  K I ++ +++  L ++L +++ G GPL+ L+  D ++DI+VNG  +
Sbjct: 91  RGEIASISGEVLQEKSIVLNREDRQQLIKELYDEVTGLGPLEALLKDDTVSDILVNGPQQ 150

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +FIE  GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 151 IFIERGGKLELSDITFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLQDGSRFNAMVPP 210

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 211 IAVDGSLVSIRKFKKDKLKIDDLVNFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 270

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 271 LNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 330

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 331 DRIIVGETRGAEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 390

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 391 SQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNKIIGHF 450

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  F  R   +G
Sbjct: 451 TATGV-RSHFSERFRLWG 467


>gi|85705155|ref|ZP_01036255.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseovarius sp. 217]
 gi|85670477|gb|EAQ25338.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseovarius sp. 217]
          Length = 430

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 204/411 (49%), Positives = 285/411 (69%), Gaps = 1/411 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R     E+K  +   +++ +++  L        R EI+++  EI+  K I ++ +++  L
Sbjct: 7   RKERISEIKIELHRAMLDHLNLAALDTATESDLRAEISSIAGEILEEKGIVLNREDRTQL 66

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ++L +++ G GPL+ L+  D + DI+VNG +++FIE  GK   + + F+D + LL +  
Sbjct: 67  TQELYDEVKGLGPLETLLKDDTVNDILVNGPHQIFIERAGKLELSDVTFKDEKHLLRIID 126

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV FG
Sbjct: 127 KIVSAVGRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKFKKDKLGIDDLVRFG 186

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           A + E A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ
Sbjct: 187 AFSEEMAAYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDNAERILTIEDTAELQLQQ 246

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HV R+E+RPPNIEG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGS
Sbjct: 247 VHVGRMESRPPNIEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGS 306

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIHANN R+   RME M+AM G  +P + VR  I S++++IVQ  RL+DGSRR+T+I 
Sbjct: 307 MTTIHANNPRDGISRMENMVAMAGIEMPLKAVRSQIASAVNLIVQASRLQDGSRRMTSIT 366

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EI GMEG+VI  Q++ +++ +G     K+IG   +TGV R  F  R   +G
Sbjct: 367 EITGMEGDVISMQEIFRFQRVGLSPENKIIGHFTATGV-RSHFSERFRLWG 416


>gi|126737251|ref|ZP_01752986.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. SK209-2-6]
 gi|126721836|gb|EBA18539.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. SK209-2-6]
          Length = 482

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/376 (52%), Positives = 275/376 (73%), Gaps = 5/376 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R+EI+ +  EI+  K I ++ +++  L ++L +++ G GPL+ L+  + ++DI+VNG ++
Sbjct: 91  RNEISAIATEILEEKSIVLNREDRQQLNKELYDEVKGLGPLEALLQDETVSDILVNGPHQ 150

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +FIE +GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 151 IFIERDGKLQLSNIAFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLQDGSRFNAMVPP 210

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 211 VAVDGSLVSIRKFKKDKLAIDDLVEFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 270

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 271 LNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 330

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 331 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 390

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I+S+++VIVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 391 SQISSAVNVIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNKIIGHF 450

Query: 447 ISTGV-----SRPRFW 457
            +TGV      R R W
Sbjct: 451 TATGVRSHYSERFRLW 466


>gi|323495640|ref|ZP_08100711.1| type ii/iv secretion system ATP hydrolase tada/virb11/cpaf, tada
           subfamily protein [Vibrio sinaloensis DSM 21326]
 gi|323319275|gb|EGA72215.1| type ii/iv secretion system ATP hydrolase tada/virb11/cpaf, tada
           subfamily protein [Vibrio sinaloensis DSM 21326]
          Length = 427

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 265/370 (71%), Gaps = 6/370 (1%)

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
           D  + L N+I G GP+Q L+  + I+DIM+NG + VF+E NG   ++ + F D +QL+ +
Sbjct: 58  DYVQSLVNEIHGLGPMQSLMEDESISDIMINGCDNVFVERNGIVEKSEVTFIDEDQLIQI 117

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RI  +VGRRVD+SSP CDARL DGSRVN++IPP+A+DG +++IRKFKK+ L+ D LV 
Sbjct: 118 AKRIAARVGRRVDDSSPTCDARLPDGSRVNIVIPPIAIDGTSVSIRKFKKNSLSFDSLVD 177

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FGA+++E A+LL I  R R N+LISGGTGSGKTT+LN L+++I + ERIVT ED AEL+L
Sbjct: 178 FGAMSSEMAKLLMIAARCRLNILISGGTGSGKTTMLNALSQFISEKERIVTIEDAAELKL 237

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQPHVVRLETR   IEG G I  RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHD
Sbjct: 238 QQPHVVRLETRTSGIEGTGAIDQRDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHD 297

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM T+HAN  R++  R+EAM+ M    LP + +R  I S++D+++Q  RL DGSR++ +
Sbjct: 298 GSMSTLHANTPRDALARVEAMVMMATNNLPLEAIRRNIVSAVDLVIQISRLHDGSRKVMS 357

Query: 412 ICEIVGMEGNVIITQDLLKY---EVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEK 467
           I E+VG+EG  ++ +++ ++   ++ G+D  GK+ G  ++ G+  R     +A  +G + 
Sbjct: 358 ISEVVGLEGQSVVLEEIFRFVPNQMQGDD--GKVRGNFVTAGLMQRSILVEKAKFFGLDS 415

Query: 468 NLAEVLQSLE 477
            L ++  + E
Sbjct: 416 QLGQLFAARE 425


>gi|159901125|ref|YP_001547372.1| type II secretion system protein E [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894164|gb|ABX07244.1| type II secretion system protein E [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 467

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 263/373 (70%), Gaps = 1/373 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R  +  L++ ++  + I +S  E+  L E L +DI+G GPL  L+  + I++IMVNG NK
Sbjct: 75  RQTVEDLLSVVLDSENIVLSRVERQQLVESLMSDIVGLGPLDSLLKDESISEIMVNGPNK 134

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           ++IE  GK   +G  F D+E  + V  RIV+ +GRR+DESSP+ DARL DGSRVN +I P
Sbjct: 135 IYIEQRGKLTLSGTTFIDDEHAMRVLYRIVSPLGRRIDESSPMVDARLQDGSRVNAVIRP 194

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           ++L GP +TIRKF K  L  + L+ FGA++ E    L    R R NV++SGGTGSGKTTL
Sbjct: 195 ISLIGPVITIRKFSKKPLGPEDLIRFGAISREMMEFLSASVRARINVVVSGGTGSGKTTL 254

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I +DER++T E+ AELQLQQ HV+ LE+R  NIEG+GEI++ DL+ NCLRMRP
Sbjct: 255 LNVLSSFIPEDERLITVENAAELQLQQDHVISLESRTANIEGKGEISINDLIINCLRMRP 314

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           ERII+GE RG E L +LQAMNTGH+GSM T+HAN  R++  R+E M  M G  LP + +R
Sbjct: 315 ERIIVGECRGGETLAMLQAMNTGHEGSMTTLHANTPRDAIARIETMCLMSGMDLPLKAIR 374

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
           E + S++++IVQ  RL+DGSRR+  I E+ GMEG++++ QD+  +E  G DE GK++G  
Sbjct: 375 EQVASAIELIVQQARLKDGSRRVMAISEVTGMEGDLVVLQDIFIFEQTGLDERGKIVGSL 434

Query: 447 ISTGVSRPRFWNR 459
             TGV RPRF +R
Sbjct: 435 RPTGV-RPRFLDR 446


>gi|254462009|ref|ZP_05075425.1| type II/IV secretion system protein, TadA subfamily
           [Rhodobacterales bacterium HTCC2083]
 gi|206678598|gb|EDZ43085.1| type II/IV secretion system protein, TadA subfamily
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 487

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 275/381 (72%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI ++  E++  K I ++ +++  L +DL +++ G GPL+ L+  DD+ DI+VNG
Sbjct: 93  QELRVEINSIAAEVLQEKGIVLNREDRTALSQDLFDEVTGLGPLETLLKDDDVNDILVNG 152

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++FIE +GK   + + F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 153 PKQIFIEKHGKLTLSDVTFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLTDGSRFNAM 212

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LV FGA + E A  LQ     R N+++SGGTGSGK
Sbjct: 213 VPPVAVDGSLVSIRKFKKDKLGIDDLVDFGAFSEEMAAYLQAAVATRLNIIVSGGTGSGK 272

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LR
Sbjct: 273 TTTLNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALR 332

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 333 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMSGIEMPLK 392

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            +R  I+S++++IVQ  RL+DGSRR+T+I EI GMEG VI  Q+L +++ +G     K+I
Sbjct: 393 AMRSQISSAVNLIVQASRLQDGSRRMTSITEITGMEGEVISMQELFRFQRVGLTPENKII 452

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G   +TGV R  +  R   +G
Sbjct: 453 GHFTATGV-RSHYAERFRMWG 472


>gi|163745843|ref|ZP_02153202.1| type II/IV secretion system protein, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380588|gb|EDQ04998.1| type II/IV secretion system protein, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 491

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 274/378 (72%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI  +  EI+S K I ++ ++++ L  +L +++ G GPL+ L+  D + DI+VNG  +
Sbjct: 101 RQEINDIAVEILSEKSIVLNREDRMTLNSELYDEVTGLGPLETLLKDDTVNDILVNGPQQ 160

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +F+E +GK   T I F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 161 IFVERDGKLQLTDITFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAMVPP 220

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV+FGA + E A  LQ     R N+++SGGTGSGKTT 
Sbjct: 221 VAVDGSLVSIRKFKKDKLGIDDLVNFGAFSEEMAAYLQAAVATRLNIIVSGGTGSGKTTT 280

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I  DERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 281 LNALSSFIANDERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 340

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 341 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLKAVR 400

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I+S++++IVQ  RL+DGSRR+T+I EI GMEG VI  Q++ +Y+ +G     K+IG  
Sbjct: 401 SQISSAVNLIVQASRLQDGSRRMTSITEITGMEGEVISMQEIFRYQRVGLTPENKIIGHF 460

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  F  R   +G
Sbjct: 461 TATGV-RSHFSERFRMWG 477


>gi|227819314|ref|YP_002823285.1| CpaF pilus assembly protein, ATPase CpaF [Sinorhizobium fredii
           NGR234]
 gi|227338313|gb|ACP22532.1| CpaF pilus assembly protein, ATPase CpaF [Sinorhizobium fredii
           NGR234]
          Length = 483

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/396 (47%), Positives = 272/396 (68%), Gaps = 1/396 (0%)

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           L++ I++  L   D +    EI  L+ E +      ++  E  DL  D+ +++LG GP++
Sbjct: 68  LLDQINLGILDTLDEEEIAAEIRPLVKEYIRRNNSPLNAKEINDLVRDITDEMLGLGPIE 127

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSP 188
           PL+A + +ADI++NG   V++E  G+   T + F+D + LL V  +IV+ VGRRVDES+P
Sbjct: 128 PLLADETVADILINGHKSVYVERRGQLESTAVRFKDEDHLLRVINKIVSAVGRRVDESTP 187

Query: 189 ICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR 248
           + DARL DGSRVNV I P+++DGP ++IRKF +  LTL+ LV +GA+  +   LL    +
Sbjct: 188 MVDARLKDGSRVNVAIRPISVDGPLVSIRKFTRKPLTLERLVEYGAMADQMRILLSAAVK 247

Query: 249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEG 308
            R +++ISGGTGSGKTTLLN L+  I + ER++T ED AELQLQQPHV R+ETRPP ++G
Sbjct: 248 GRVSMIISGGTGSGKTTLLNALSSQISEKERLITIEDAAELQLQQPHVGRMETRPPTLDG 307

Query: 309 EGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGR 368
             EI  R+L+KN LRMRP+RII+GEVRG E  D+LQAMNTGH+GSM TIHAN  R++  R
Sbjct: 308 RNEIRQRELLKNALRMRPDRIIVGEVRGEEAFDMLQAMNTGHEGSMTTIHANTPRDAVSR 367

Query: 369 MEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL 428
           +E M+ M G  +    VR  I S++ +IVQ QRL DGSR++ ++ EI GMEG V+  Q++
Sbjct: 368 LEQMVGMAGMPMSQLSVRSQIASAITIIVQVQRLSDGSRKVVSVSEITGMEGEVVQMQEI 427

Query: 429 LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           ++++  G DE G++ G+  +TG+ RPRF    A+ G
Sbjct: 428 MRFKKTGTDENGRIQGEFRATGL-RPRFIEEFAEVG 462


>gi|219883048|ref|YP_002478212.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
 gi|219862054|gb|ACL42395.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
          Length = 465

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/380 (51%), Positives = 276/380 (72%), Gaps = 6/380 (1%)

Query: 86  ARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSN 145
           AR+E    + +IV  + + ++ DE+  L   + +D++GYGPLQ L+  + +++IMVNG +
Sbjct: 74  AREE----LTQIVDAESVPLTGDEKQRLVSQISDDVMGYGPLQKLLDDESVSEIMVNGPD 129

Query: 146 KVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIP 205
           ++F+E NG+  E+   F+  + L  V ++IV++VGRR+DESSP+ DARL DGSRVN +IP
Sbjct: 130 QIFVEQNGRVTESDARFKTEDHLRRVIEKIVSRVGRRIDESSPMVDARLADGSRVNAVIP 189

Query: 206 PLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTT 265
           PLA++G +LTIRKF  D L    LV FG+++ E A LL    +   N+++SGGTG+GKTT
Sbjct: 190 PLAVNGSSLTIRKFAADPLKAADLVRFGSISPEMAELLDACVKAHLNIIVSGGTGTGKTT 249

Query: 266 LLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR 325
           LLN L+ +I   ERIVT ED  ELQLQQ HVVRLE+RP N+EG+GEIT+RDL+KN LRMR
Sbjct: 250 LLNVLSSFIPPGERIVTIEDAVELQLQQNHVVRLESRPSNVEGKGEITIRDLLKNSLRMR 309

Query: 326 PERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMV 385
           P+RI++GE RG E LD+LQAMNTGHDGS+ TIH+N+ R++  RME ++ M G  LP + V
Sbjct: 310 PDRIVVGECRGGEALDMLQAMNTGHDGSLSTIHSNSPRDAISRMETLVLMAGMDLPLRAV 369

Query: 386 REIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIG 444
           RE I S++DVIVQ  RLRDGSRR+T++ E+ GMEG+V+  QD   ++   G DE G+ +G
Sbjct: 370 REQIASAVDVIVQLTRLRDGSRRVTHVTEVQGMEGDVVTLQDAFVFDYSAGVDEDGRFLG 429

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           + +STGV RP+F ++    G
Sbjct: 430 KPVSTGV-RPKFTDKFNDLG 448


>gi|217978829|ref|YP_002362976.1| type II secretion system protein E [Methylocella silvestris BL2]
 gi|217504205|gb|ACK51614.1| type II secretion system protein E [Methylocella silvestris BL2]
          Length = 462

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 276/397 (69%), Gaps = 5/397 (1%)

Query: 86  ARDEIATLMN----EIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMV 141
           ++ E+A  +N    EI + +K  ++ DEQ  L   + ++++G GP++PL+    +ADI++
Sbjct: 63  SKQELAIFVNQLVAEIANERKFLLNHDEQHTLATSIVDEMVGLGPIEPLLRDRTVADILI 122

Query: 142 NGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVN 201
           NG   +++E  GK   T + FR +  +L V QRI + +GRR+DESSP+ DARL DGSRVN
Sbjct: 123 NGPRMIYVERRGKLELTKLQFRSDAHVLHVAQRIASSIGRRIDESSPMLDARLQDGSRVN 182

Query: 202 VIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGS 261
           VIIPPL+L GP ++IRKF K  L  +  ++ G V+ + AR L+I  R R N+++SGGTGS
Sbjct: 183 VIIPPLSLKGPCVSIRKFSKTTLDFNSFIASGTVSPDLARALEIAARCRLNIIVSGGTGS 242

Query: 262 GKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNC 321
           GKTT+LN L+R ID+ ERI+T ED AELQLQQ HVV+LETRP NIEG GEI+ RDL++N 
Sbjct: 243 GKTTMLNSLSRMIDQGERIITIEDAAELQLQQAHVVQLETRPQNIEGRGEISQRDLMRNA 302

Query: 322 LRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLP 381
           LRMRP+RII+GEVRG E  D++QAMNTGH+GSM T+H+N AR++  R+E MI MG   LP
Sbjct: 303 LRMRPDRIIMGEVRGSEAFDMMQAMNTGHNGSMSTVHSNTARDALARIENMILMGVGNLP 362

Query: 382 SQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGK 441
            + +R  I+S++D++VQT+R+RDG RR+T + E+VG+EG+VI    L KY+  GE+  G 
Sbjct: 363 IRAIRAQISSAIDLVVQTERMRDGVRRVTEVVEVVGLEGDVITLGTLFKYQFQGENPDGS 422

Query: 442 LIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLEK 478
           L G   +T   RPRF  R   +G      E L   EK
Sbjct: 423 LKGFFEATPC-RPRFLPRLEYFGLGAAFLETLGVNEK 458


>gi|323702116|ref|ZP_08113784.1| type II secretion system protein E [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532998|gb|EGB22869.1| type II secretion system protein E [Desulfotomaculum nigrificans
           DSM 574]
          Length = 457

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 282/394 (71%), Gaps = 1/394 (0%)

Query: 71  EMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           E+ D+ +  + +      +I T++N ++  ++ T++  ++  +  ++ ++ +G+GP+ PL
Sbjct: 52  ELKDVPEDIKENPDQLAKKIETIVNNLLDQEEQTIARTQRQLIIAEIIDETIGFGPITPL 111

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +    I+++MVNG ++V++E +GK + TG+ FRDN  +L +  +IV  +GRR+DES P+ 
Sbjct: 112 LNDPAISEVMVNGPHQVYVERDGKLMLTGVTFRDNAHVLHIIDKIVAPIGRRIDESMPMV 171

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           DARL DGSRVN IIPPLAL+GPT+TIRKF +D  T+D L+ FG +T + A+ L+   + R
Sbjct: 172 DARLPDGSRVNAIIPPLALNGPTITIRKFARDPYTVDDLIKFGTLTPQMAQFLEACVKAR 231

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTT LN L+ +I  DERI+T ED AELQL+Q HV+ LE+RPPNIEG+G
Sbjct: 232 LNIVVSGGTGSGKTTTLNVLSSFIPPDERIITIEDAAELQLRQEHVITLESRPPNIEGKG 291

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
            IT+RDLV+N LRMRPERI++GEVR  E LD+LQAMNTGHDGS+ T HAN+ R+   R+E
Sbjct: 292 AITIRDLVRNSLRMRPERIVVGEVRSGEALDMLQAMNTGHDGSLTTGHANSPRDMLARLE 351

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
            M+ M G  LP + +RE I+S++D+I+   RLRDGSRRIT+I E+ GMEG VII QDL  
Sbjct: 352 TMVLMAGMDLPIRAIREQISSAIDLIIHQSRLRDGSRRITHITEVQGMEGEVIILQDLFT 411

Query: 431 YEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           Y   G  E GK+ G   STG+ RP+F +R    G
Sbjct: 412 YRQTGVTEDGKIKGTFQSTGI-RPKFIHRLEASG 444


>gi|284991840|ref|YP_003410394.1| type II secretion system protein E [Geodermatophilus obscurus DSM
           43160]
 gi|284065085|gb|ADB76023.1| type II secretion system protein E [Geodermatophilus obscurus DSM
           43160]
          Length = 468

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 267/372 (71%), Gaps = 2/372 (0%)

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           ++E+V  +++ +S +E+  L  +L +D+LGYGPLQ L+    + +IM NG + V++E +G
Sbjct: 80  LDEVVEEERVPLSAEERGRLTAELADDVLGYGPLQRLLDDPSVTEIMCNGPDAVYVEQDG 139

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           + V T   F   E L  V  RIV++VGRR+DESSP+ DARL DGSRVN IIPPLA  G T
Sbjct: 140 RLVRTAARFTSEEHLRRVIDRIVSRVGRRIDESSPLVDARLADGSRVNAIIPPLAFSGST 199

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           LTIRKF KD  T+D L+ FG ++ E A LL+     R NV++SGGTG+GKTTLLN L+ +
Sbjct: 200 LTIRKFAKDPFTVDDLIGFGTLSPEMAELLRACVEARLNVIVSGGTGTGKTTLLNVLSSF 259

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           I   ERIVT ED  ELQLQQ HVVRLE+RPPNIEG+G IT+RDLV+N LRMRP+RI++GE
Sbjct: 260 IPDGERIVTIEDAVELQLQQDHVVRLESRPPNIEGKGAITIRDLVRNSLRMRPDRIVVGE 319

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
            RG E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E ++ M G  LP + +RE I S++
Sbjct: 320 CRGGESLDMLQAMNTGHDGSLSTVHANSPRDAIARLETLVLMAGMDLPLRAIREQIASAV 379

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQHISTGVS 452
           DV+VQ  RLRDG+RR+T++ E+ GMEG  +  QD   ++   G D  G+ +G+ + TGV 
Sbjct: 380 DVVVQLTRLRDGTRRVTHVTEVQGMEGETVTLQDAFLFDYSAGVDAAGRFLGKPVPTGV- 438

Query: 453 RPRFWNRAAQYG 464
           RPRF +R  + G
Sbjct: 439 RPRFTDRFDELG 450


>gi|254506208|ref|ZP_05118352.1| TadA [Vibrio parahaemolyticus 16]
 gi|219551026|gb|EED28007.1| TadA [Vibrio parahaemolyticus 16]
          Length = 427

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/419 (47%), Positives = 279/419 (66%), Gaps = 18/419 (4%)

Query: 58  YYEVKSTIFTTL-IEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +  ++S IF  L  E + +    Q   Q A      +  +  SV  I      + D  + 
Sbjct: 8   FIAIRSQIFEALDSEAVTVLSKEQLSKQLAEAVELLIERQGWSVPSIV-----KADYVQS 62

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           L N+I G GP+Q L+  + I+DIM+NG + VF+E NG   ++ + F D +QL+ + +RI 
Sbjct: 63  LVNEIHGLGPMQSLMEDESISDIMINGCDNVFVERNGLVEKSEVTFIDEDQLIQIAKRIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
            +VGRRVD+SSP CDARL DGSRVN++IPP+A+DG +++IRKFKK  L+ D LV FGA++
Sbjct: 123 ARVGRRVDDSSPTCDARLPDGSRVNIVIPPIAIDGTSISIRKFKKGSLSFDALVEFGAMS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A+LL I  R R N+LISGGTGSGKTT+LN L+++I + ERIVT ED AEL+LQQPHV
Sbjct: 183 PEMAKLLMIAARCRLNILISGGTGSGKTTMLNALSQFISEKERIVTIEDAAELKLQQPHV 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETR   IEG G I  RDLV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRTSGIEGTGAIDQRDLVINSLRMRPDRIIVGECRGGEAFEMLQAMNTGHDGSMST 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+EAM+ M    LP + +R  I S++D+++Q  RL DGSR++ +I E+V
Sbjct: 303 LHANTPRDALARVEAMVMMATNNLPLEAIRRNIVSAVDLVIQISRLHDGSRKVMSISEVV 362

Query: 417 GMEGNVIITQDLLKY---EVMGEDETGKLIGQHISTG-------VSRPRFWNRAAQYGE 465
           G+EG  ++ +++ ++   ++ G+D  GK+ G  ++ G       V + +F+   AQ G+
Sbjct: 363 GLEGQSVVLEEIFRFVPNQMQGDD--GKVRGNFMTAGLMQRSVLVEKAKFFGLDAQLGQ 419


>gi|86137996|ref|ZP_01056572.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseobacter sp. MED193]
 gi|85825588|gb|EAQ45787.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseobacter sp. MED193]
          Length = 479

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/376 (52%), Positives = 275/376 (73%), Gaps = 5/376 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI+ +  EI+  K I ++ ++++ L ++L +++ G GPL+ L+  + ++DI+VNG ++
Sbjct: 88  RGEISAIAAEILEEKGIVLNREDRMTLNKELYDEVTGLGPLETLLQDETVSDILVNGPHQ 147

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +FIE +GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 148 IFIERSGKLQLSNIAFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 207

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 208 VAVDGSLVSIRKFKKDKLGIDDLVEFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 267

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 268 LNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 327

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 328 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGMEMPIKAVR 387

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I+S+++VIVQ  RL+DGSRR+T+I EI GMEG+VI  Q+L +++ +G     K+IG  
Sbjct: 388 SQISSAVNVIVQASRLQDGSRRMTSITEITGMEGDVISMQELFRFQRVGLTPDNKIIGHF 447

Query: 447 ISTGV-----SRPRFW 457
            ++GV      R R W
Sbjct: 448 TASGVRSHYSERFRLW 463


>gi|83954509|ref|ZP_00963220.1| type II/IV secretion system protein, TadA subfamily protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840793|gb|EAP79964.1| type II/IV secretion system protein, TadA subfamily protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 481

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 273/381 (71%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI  +  EI++ K I ++ +++  L  +L +++ G GPL+ L+  D + DI+VNG
Sbjct: 88  QDLRSEINEISTEILAEKSIVLNREDRFQLNSELYDEVTGLGPLETLLKDDSVNDILVNG 147

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++F+E  GK   T + F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 148 PQQIFVERAGKLQLTDVTFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAM 207

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LVSFGA + E A  LQ     R N+++SGGTGSGK
Sbjct: 208 VPPIAVDGSLVSIRKFKKDKLGIDDLVSFGAFSEEMAAYLQAAVATRLNIIVSGGTGSGK 267

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +I  DERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LR
Sbjct: 268 TTTLNALSSFIANDERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALR 327

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 328 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLK 387

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            VR  I+S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+I
Sbjct: 388 AVRSQISSAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPENKII 447

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G    TGV R  F  R   +G
Sbjct: 448 GHFTGTGV-RSHFSERFKMWG 467


>gi|83943936|ref|ZP_00956393.1| type II/IV secretion system protein, TadA subfamily protein
           [Sulfitobacter sp. EE-36]
 gi|83845183|gb|EAP83063.1| type II/IV secretion system protein, TadA subfamily protein
           [Sulfitobacter sp. EE-36]
          Length = 481

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 274/381 (71%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI  +  EI++ K I ++ ++++ L  +L +++ G GPL+ L+  D + DI+VNG
Sbjct: 88  QDLRSEINEISTEILAEKSIVLNREDRVQLNSELYDEVTGLGPLETLLKDDSVNDILVNG 147

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++F+E  GK   T + F+D + LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 148 PQQIFVERAGKLQLTDVTFKDEKHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAM 207

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LVSFGA + E A  LQ     R N+++SGGTGSGK
Sbjct: 208 VPPIAVDGSLVSIRKFKKDKLGIDDLVSFGAFSEEMAAYLQAAVATRLNIIVSGGTGSGK 267

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +I  DERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LR
Sbjct: 268 TTTLNALSSFIANDERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALR 327

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 328 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLK 387

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            VR  I+S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+I
Sbjct: 388 AVRSQISSAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPENKII 447

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G    TGV R  F  R   +G
Sbjct: 448 GHFTGTGV-RSHFSERFKMWG 467


>gi|32473985|ref|NP_866979.1| secretion system protein TadA [Rhodopirellula baltica SH 1]
 gi|32444522|emb|CAD74521.1| secretion system protein TadA [Rhodopirellula baltica SH 1]
          Length = 459

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/430 (44%), Positives = 286/430 (66%), Gaps = 5/430 (1%)

Query: 35  QNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLM 94
           + ++ ++P    E     NR   + ++K  I   L++ +D++++      + + EI  ++
Sbjct: 19  RTMRQAAPPQRPE----ANRQEQFEQIKRRIHGKLVDKLDLSRVGDLQGDTLKREIRMVV 74

Query: 95  NEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGK 154
             +   +   ++  E+  + +++ ++  G GPL+ ++    ++DI++NG   +++E  G+
Sbjct: 75  EHLCDAEDTLLNRQERERIVDEVLDETFGLGPLELILKDPKVSDILINGPKNIYVEKGGQ 134

Query: 155 TVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTL 214
             +T + FRD + LL +  RIV++VGRRVDE+ P+ DARL DGSRVN IIPPLALDG  +
Sbjct: 135 MQKTDVEFRDGKHLLQIIDRIVSKVGRRVDETCPMVDARLDDGSRVNAIIPPLALDGAAV 194

Query: 215 TIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYI 274
           +IR+F  + L L+ L+++ A T E   LL+   + R N++I+GGTGSGKTTLLN L+ +I
Sbjct: 195 SIRRFGSNPLRLEDLLNYRAFTPEMVMLLEGCIKARLNMIIAGGTGSGKTTLLNTLSSFI 254

Query: 275 DKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEV 334
             ++RIVT ED AELQLQQ HVVRLETRPPNIEG G +T  DLVKN LRMRPERII+GE 
Sbjct: 255 GHEDRIVTIEDAAELQLQQDHVVRLETRPPNIEGNGAVTATDLVKNALRMRPERIIIGEC 314

Query: 335 RGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLD 394
           RG E LD+LQAMNTGHDGS+ TIHAN  R++  R+E ++ M GF LP + +R+ ++ ++D
Sbjct: 315 RGGETLDMLQAMNTGHDGSLTTIHANTPRDAIARLETLVMMSGFELPVKAIRQQVSGAVD 374

Query: 395 VIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRP 454
           V++Q  RL+ G RR+T I E+VGME + II QD+ ++   G +  GK  GQ + +GV RP
Sbjct: 375 VLIQANRLQGGPRRVTAITEVVGMEQDTIILQDIYRFNQKGINAEGKAHGQFVCSGV-RP 433

Query: 455 RFWNRAAQYG 464
            F ++    G
Sbjct: 434 SFMDKLEAAG 443


>gi|327543262|gb|EGF29695.1| type II/IV secretion system protein, TadA subfamily protein
           [Rhodopirellula baltica WH47]
          Length = 439

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/413 (45%), Positives = 279/413 (67%), Gaps = 1/413 (0%)

Query: 52  VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
            NR   + ++K  I   L++ +D++++      + + EI  ++  +   +   ++  E+ 
Sbjct: 12  ANRQEQFEQIKRRIHGKLVDKLDLSRVGDLQGDTLKREIRMVVEHLCDAEDTLLNRQERE 71

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            + +++ ++  G GPL+ ++    ++DI++NG   +++E  G+  +T + FRD + LL +
Sbjct: 72  RIVDEVLDETFGLGPLELILKDPKVSDILINGPKNIYVEKGGQMQKTDVEFRDGKHLLQI 131

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
             RIV++VGRRVDE+ P+ DARL DGSRVN IIPPLALDG  ++IR+F  + L L+ L++
Sbjct: 132 IDRIVSKVGRRVDETCPMVDARLDDGSRVNAIIPPLALDGAAVSIRRFGSNPLRLEDLLN 191

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           + A T E   LL+   + R N++I+GGTGSGKTTLLN L+ +I  ++RIVT ED AELQL
Sbjct: 192 YRAFTPEMVMLLEGCIKARLNMIIAGGTGSGKTTLLNTLSSFIGHEDRIVTIEDAAELQL 251

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
           QQ HVVRLETRPPNIEG G +T  DLVKN LRMRPERII+GE RG E LD+LQAMNTGHD
Sbjct: 252 QQDHVVRLETRPPNIEGNGAVTATDLVKNALRMRPERIIIGECRGGETLDMLQAMNTGHD 311

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ TIHAN  R++  R+E ++ M GF LP + +R+ ++ ++DV++Q  RL+ G RR+T 
Sbjct: 312 GSLTTIHANTPRDAIARLETLVMMSGFELPVKAIRQQVSGAVDVLIQANRLQGGPRRVTA 371

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I E+VGME + II QD+ ++   G +  GK  GQ + +GV RP F ++    G
Sbjct: 372 ITEVVGMEQDTIILQDIYRFNQKGINAEGKAHGQFVCSGV-RPSFMDKLEAAG 423


>gi|188586924|ref|YP_001918469.1| type II secretion system protein E [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351611|gb|ACB85881.1| type II secretion system protein E [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 677

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 211/460 (45%), Positives = 299/460 (65%), Gaps = 9/460 (1%)

Query: 3   GRRDKKLMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNF-----VNRTPH 57
           GR    L+  + +        E    S+   + N Q++S    G+ G       V     
Sbjct: 209 GRGKASLLSRLNKRKQEAALMESAKGSNKSNQPNNQTTSQPKSGKNGRAKANGQVEDKDD 268

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSA----RDEIATLMNEIVSVKKITMSLDEQLDL 113
           + E+KS +   LI+ ID   L + +S+      + EI   +  ++  ++  +S  ++  +
Sbjct: 269 FRELKSRLHRALIDEIDKDILQESNSEDEELELKSEIEETVENLLDQEEKPLSSTDRDKI 328

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
             ++ N+ LG+GP+ PLI  +++++IMVNG ++V++E NGK   T I FRD + ++ V +
Sbjct: 329 KAEILNETLGFGPITPLIEDENVSEIMVNGHDQVYVEENGKLKLTDIKFRDEQHVIHVIE 388

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +IV  +GRR+DESSP+ DARL DGSRVN IIPPL+L GP +TIRKF +D LT   L+SFG
Sbjct: 389 KIVAPLGRRIDESSPMVDARLPDGSRVNAIIPPLSLTGPVITIRKFSEDPLTAKDLISFG 448

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            +T E +  L+   + R NV++SGGTGSGKTT LN L+ +I +DERIVT ED AEL L Q
Sbjct: 449 TMTTEISDFLKKCVKNRLNVVVSGGTGSGKTTTLNVLSSFIPQDERIVTIEDAAELTLHQ 508

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HVV LET+PPN+EG+G ITMR+LV+N LRMRP+RI++GEVRG E LD+LQAMNTGHDGS
Sbjct: 509 DHVVTLETKPPNMEGKGAITMRELVRNSLRMRPDRIVVGEVRGGEALDMLQAMNTGHDGS 568

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + T HAN+ R+   R+E M+ M G  LP + +RE I S++D++VQ  RL DGSR+IT + 
Sbjct: 569 LTTGHANSPRDMLSRLETMVLMAGMDLPIRAIREQIASAIDLVVQQSRLEDGSRKITQVS 628

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSR 453
           E+ GMEG+VI  QDL  Y+  G D   K+ G+H STG + 
Sbjct: 629 EVQGMEGDVITMQDLFTYKRQGRDSKNKITGKHESTGFTH 668


>gi|261251595|ref|ZP_05944169.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
 gi|260938468|gb|EEX94456.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
          Length = 445

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 282/417 (67%), Gaps = 4/417 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +Y+V        IE   + +LS  D +     I  L+++IVS  ++ +   E   + + L
Sbjct: 30  HYQVIHAKVIKAIEPSVVVKLSPADLEG---RIHHLVSDIVSADQLPLGHREVFTVVKQL 86

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPLQPL+    I DIMVNG  +V++E  GK  +T + FR  EQLL++ +RIV+
Sbjct: 87  VDEMCGLGPLQPLLNDPVITDIMVNGYKEVYVEKLGKLQKTDVVFRSEEQLLNLARRIVS 146

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRR+DE+SP+ DARL DGSRVNV+IPPLALDG  ++IRKF +DKL+L+ L + G++++
Sbjct: 147 KIGRRIDETSPLVDARLEDGSRVNVMIPPLALDGTYISIRKFTQDKLSLNQLATNGSMSS 206

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
              +LL +I R R NVL++GGTG+GKTTLLN ++  I   ERIVT ED AEL+LQQPHVV
Sbjct: 207 NMVQLLDVIVRSRLNVLVAGGTGAGKTTLLNAMSFSISPTERIVTIEDAAELKLQQPHVV 266

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R ETRP N EG   I  R+LVKN LRMRP+RIILGEVRG E  +++QAMNTGHDGS+ T+
Sbjct: 267 RAETRPANAEGLPAIGQRELVKNSLRMRPDRIILGEVRGEEAFEMMQAMNTGHDGSLSTL 326

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+  ++  R+E M+ M    LP   +R  +  ++DV+VQ +R+RDG RR+  I EI+G
Sbjct: 327 HANSPTDALVRLENMLMMAQSNLPLFALRRQVADTIDVVVQVERMRDGKRRVVAITEIIG 386

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           +EG   +TQDL +Y + GED  G L G + S+  + P+F  +AA Y  E  L   ++
Sbjct: 387 LEGEQYVTQDLYRYVMSGEDVQGNLQGVYQSSR-TLPQFVTKAAYYQLEPLLRRAME 442


>gi|307726378|ref|YP_003909591.1| type II secretion system protein E [Burkholderia sp. CCGE1003]
 gi|307586903|gb|ADN60300.1| type II secretion system protein E [Burkholderia sp. CCGE1003]
          Length = 455

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/407 (45%), Positives = 278/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  +K  +   +++ +++ +L++  ++  R EI  L+  I+   K  ++  E+  L  D+
Sbjct: 33  YQTLKRKVHEAVLDRVELERLARLPAEQVRQEIGGLIARILEEDKAPVNDLERRQLTTDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN     ++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  HDEMFGFGPLEALLRDPTVSDILVNTHRTTYVERRGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +  L++  ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAVDGPLMSIRRFAVNPLQMSDLIASQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I + ER+VT ED AELQL+Q HV+
Sbjct: 213 PMAELLDALTRAKVNVLVSGGTGSGKTTLLNILSGFIPEGERVVTIEDAAELQLRQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+T R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNVEGRGEVTQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G  LP + +R+ I+S++ V+VQ  RL DG R++ +I E+ G
Sbjct: 333 HANTPRDALTRLENMISLAGLALPPKNLRQQISSAISVVVQVARLTDGRRKVVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG ++  Q++  +   G D+TG + G   +TGV RPRF  R   +G
Sbjct: 393 MEGEMVNMQEIFTFRRTGVDQTGAVRGHFCATGV-RPRFTERLQAFG 438


>gi|126729095|ref|ZP_01744909.1| type II/IV secretion system protein, TadA subfamily [Sagittula
           stellata E-37]
 gi|126710085|gb|EBA09137.1| type II/IV secretion system protein, TadA subfamily [Sagittula
           stellata E-37]
          Length = 485

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 276/378 (73%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R+EI+ +  E ++ + I ++ DE+  +  DL +++ G GPL+ L+  + ++DI+VNG ++
Sbjct: 95  REEISQIATESLTERGIVLNRDERRLMMTDLYDEVKGLGPLEALLKDETVSDILVNGPHQ 154

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +F+E +GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL+DGSR N ++PP
Sbjct: 155 IFVERSGKLQLSDITFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLMDGSRFNAMVPP 214

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R N+++SGGTGSGKTT 
Sbjct: 215 IAIDGSLVSIRKFKKDKLGIDDLVNFGAFTEEMAVYLQAAVATRLNIIVSGGTGSGKTTT 274

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD +KN LRMRP
Sbjct: 275 LNALSSFIDDSERILTIEDTAELQLQQSHVGRMESRPPNVEGKGAVTPRDCLKNALRMRP 334

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 335 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVARLENMIAMAGIEMPLKAVR 394

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +Y+ +G     K+IG  
Sbjct: 395 SQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRYQRVGLTPDNKIIGHF 454

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  F  R   +G
Sbjct: 455 TATGV-RSAFSERFRMWG 471


>gi|323493500|ref|ZP_08098622.1| Flp pilus assembly protein TadA [Vibrio brasiliensis LMG 20546]
 gi|323312323|gb|EGA65465.1| Flp pilus assembly protein TadA [Vibrio brasiliensis LMG 20546]
          Length = 445

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/441 (45%), Positives = 291/441 (65%), Gaps = 4/441 (0%)

Query: 34  KQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATL 93
           ++ + SS+ S      + V+    +Y+    I   ++E I+ + + +         I  L
Sbjct: 6   RRKVDSSAASTTKRAMSPVDPAREHYQY---IHGKVVEAIEPSVVVKLSPVELEGRIHHL 62

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           + +IVS  ++ +   E   + + L +++ G GPLQPLI    ++DIMVNG  +V++E  G
Sbjct: 63  VTDIVSAGQLPLGHREVSSVVKQLVDEMCGLGPLQPLINDPAVSDIMVNGYKEVYVEKLG 122

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           K  +T + FR  EQL+++ +RIV+++GRR+DE+SP+ DARL DGSRVNV+IPPLALDG  
Sbjct: 123 KLHKTDVVFRSEEQLINLARRIVSKIGRRIDETSPLVDARLEDGSRVNVMIPPLALDGTY 182

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           ++IRKF +DKL+L+ L + GA++    +LL +I R R NVL++GGTG+GKTTLLN ++  
Sbjct: 183 ISIRKFTQDKLSLNQLAANGAMSDNMVQLLDVIIRSRLNVLVAGGTGAGKTTLLNAMSFS 242

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           I   ERIVT ED AEL+LQQPHVVR ETRP N EG   I  R+LVKN LRMRP+RIILGE
Sbjct: 243 ISPTERIVTIEDAAELKLQQPHVVRAETRPANAEGLPAIGQRELVKNSLRMRPDRIILGE 302

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
           VRG E  +++QAMNTGHDGS+ T+HAN+  ++  R+E M+ M    LP   +R  +  ++
Sbjct: 303 VRGEEAFEMMQAMNTGHDGSLSTLHANSPTDALVRLENMLMMAQSNLPLFALRRQVADTI 362

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSR 453
           DV+VQ +R+RDG RR+  I EI+G+EG+  ++QDL +Y   GED  G LIG   S+  + 
Sbjct: 363 DVVVQVERMRDGKRRVVAITEILGLEGDQYVSQDLYRYISSGEDVQGNLIGTFKSSR-TL 421

Query: 454 PRFWNRAAQYGEEKNLAEVLQ 474
           P+F  +AA Y  E  L   ++
Sbjct: 422 PQFAAKAAHYQLEPQLRRAME 442


>gi|269926134|ref|YP_003322757.1| type II secretion system protein E [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789794|gb|ACZ41935.1| type II secretion system protein E [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 472

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/409 (46%), Positives = 285/409 (69%), Gaps = 5/409 (1%)

Query: 57  HYYEVKSTIFTTLIEMIDIT-QLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           +++++KS +   L+E +D+   +   +  + R  +  + NEI++ + I +   +++ LFE
Sbjct: 55  NWHQIKSLVQRRLLEEVDLGGNIDAENITTIRRTLEGMFNEILAEENIQLPRPDRVRLFE 114

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            +  +IL +GPL+PL+  + I +IMVNG + V++E NG+  ET + F + E +  + +RI
Sbjct: 115 AISAEILAFGPLEPLLQDETITEIMVNGPDHVWVERNGRLEETNVKFDNEEHVRRIIERI 174

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           +  +GRR DE+SP+ DARL DGSRVN IIPPL+L GP LTIRKF  D LT++ L+ FG +
Sbjct: 175 IAPLGRRCDENSPMVDARLPDGSRVNAIIPPLSLVGPVLTIRKFSADPLTVNDLLQFGTL 234

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T      L+   + R N+++SGGTGSGKTTLLN L+ +I  +ERI+T ED AELQL+Q H
Sbjct: 235 TPPVVEFLKACVKGRLNMVVSGGTGSGKTTLLNVLSSFIPDNERIITIEDAAELQLRQRH 294

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE RPPN EG+GEIT+RDLV N LRMRP+RII+GEVR  E LD+LQAMNTGHDGS+ 
Sbjct: 295 VVRLEKRPPNAEGKGEITIRDLVVNSLRMRPDRIIVGEVRSGEALDMLQAMNTGHDGSLT 354

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+H+N+ R++  R+E M+ M G  LP + +RE I S++D+IV  +RL+DGSR++  I E+
Sbjct: 355 TLHSNSPRDTLARLETMVLMSGMDLPLRAIREQIASAIDIIVHQERLQDGSRKVVKISEV 414

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGK-LIGQHISTGVSRPRFWNRAAQY 463
            GMEG+ I+ QD+ ++   G    G+ ++G+ ++ G +RP+   + A +
Sbjct: 415 QGMEGDTIVLQDIFEFRQYG--MVGRQVVGELVAKG-TRPKCLEKLAAH 460


>gi|146276358|ref|YP_001166517.1| type II secretion system protein E [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554599|gb|ABP69212.1| type II secretion system protein E [Rhodobacter sphaeroides ATCC
           17025]
          Length = 484

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/380 (52%), Positives = 275/380 (72%), Gaps = 1/380 (0%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           S R EIA +  E +    + ++ +E+  L ++L ++++G GPL+PL+  + I DI+VNG 
Sbjct: 94  SLRTEIAAICGEALEEMSVVLNKEERTILNQELYDEVMGLGPLEPLLKDETINDILVNGP 153

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
           N++F+E  G+   T   F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++
Sbjct: 154 NRIFVERGGRLELTDTTFKDERHLLRIIDKIVSAVGRRVDESTPYVDARLADGSRFNAMV 213

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PP+A+DG  ++IRKFKKDKL +  LV FGA T E A  LQ     R N+++SGGTGSGKT
Sbjct: 214 PPIAVDGSLVSIRKFKKDKLGIADLVRFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGKT 273

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           T LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRM
Sbjct: 274 TTLNALSSFIDHSERILTIEDTAELQLQQVHVGRMESRPPNVEGKGAVTQRDCLRNALRM 333

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E M+AM G  +P + 
Sbjct: 334 RPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMVAMAGIEMPIKA 393

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIG 444
           VR  I S++++IVQ  RL+DGSRR+ +I EI GMEG+VI  Q++ +YE +G + +GK++G
Sbjct: 394 VRAQIASAVNLIVQASRLQDGSRRMVSITEITGMEGDVISMQEIFRYERLGVEPSGKIVG 453

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           +  +TGV R  + +R  Q+G
Sbjct: 454 RFNATGV-RSHYSDRFRQWG 472


>gi|163738367|ref|ZP_02145782.1| type II secretion system protein E [Phaeobacter gallaeciensis
           BS107]
 gi|161388288|gb|EDQ12642.1| type II secretion system protein E [Phaeobacter gallaeciensis
           BS107]
          Length = 481

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/376 (52%), Positives = 272/376 (72%), Gaps = 5/376 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI+++  EI+  K I ++ +++  L ++L +++ G GPL+ L+  D + DI+VNG  +
Sbjct: 89  RAEISSIATEILEEKGIVLNREDRQTLTKELYDEVTGLGPLETLLQDDTVNDILVNGPQQ 148

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           VF+E +GK   + + F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 149 VFVERDGKLQLSDVTFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 208

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LVSFGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 209 VAVDGSLVSIRKFKKDKLGIDDLVSFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 268

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG GE++ RD +KN LRMRP
Sbjct: 269 LNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGRGEVSPRDCLKNALRMRP 328

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 329 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 388

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 389 SQIASAVNIIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPENKIIGHF 448

Query: 447 ISTGV-----SRPRFW 457
            +TGV      R R W
Sbjct: 449 TATGVRSHYSERFRLW 464


>gi|295700367|ref|YP_003608260.1| type II secretion system protein E [Burkholderia sp. CCGE1002]
 gi|295439580|gb|ADG18749.1| type II secretion system protein E [Burkholderia sp. CCGE1002]
          Length = 453

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/407 (47%), Positives = 276/407 (67%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++K  I   ++E +++ +LS+   +  R EIATL+  I+  +K   +  E+  L  D+
Sbjct: 31  YQKLKREIHQAVLERVELERLSRLPPEQVRQEIATLIGRILEDQKAPANDLERRQLVGDV 90

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN     ++E  G+   T + F D+  L+ V ++IV+
Sbjct: 91  HDEMFGFGPLEVLLRDPTVSDILVNTHRHTYVERRGRLEPTDVTFYDDAHLMKVIEKIVS 150

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGR +DESSP+ DARL DGSRVN II P A+DGP L+IR+F  + L +  L+   ++T 
Sbjct: 151 GVGRHIDESSPMVDARLPDGSRVNAIIRPCAIDGPLLSIRRFAANPLQVADLIELQSLTP 210

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A +L  + R + N+L+SGGTGSGKTTLLN L+ +I  DERIVT ED AELQL+Q HV+
Sbjct: 211 PMAEVLDALARAKVNILVSGGTGSGKTTLLNVLSGFIPGDERIVTIEDAAELQLRQQHVL 270

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETR PNIEG GEIT R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 271 RLETRSPNIEGRGEITQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLSTI 330

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ +GG +LP++ +R+ I+S++ V+VQ  RL DG R+I +I E+ G
Sbjct: 331 HANTPRDALTRLENMMTLGGLSLPTRTMRQQISSAISVVVQATRLTDGRRKIVSISELTG 390

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG++I  Q++  +   G D  G + G   +TGV RP+F  R   +G
Sbjct: 391 MEGDMINMQEIFVFRRSGVDTKGNVRGHFCATGV-RPKFAERLQAFG 436


>gi|302391031|ref|YP_003826851.1| type II secretion system protein E [Acetohalobium arabaticum DSM
           5501]
 gi|302203108|gb|ADL11786.1| type II secretion system protein E [Acetohalobium arabaticum DSM
           5501]
          Length = 458

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 279/385 (72%), Gaps = 1/385 (0%)

Query: 80  QYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADI 139
           + + Q  + +I  L  E++  +++ +S  ++  + +D+ ++I+G+GP+  L+   ++ ++
Sbjct: 64  EAEDQQLKQDIKDLTQEVIEAEEVHISPGDRRKVIQDIIDEIIGFGPINGLLEDPEVTEV 123

Query: 140 MVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSR 199
           MVNG ++V++E +GK V T + FRD+E ++ + ++IV  +GRR+DESSP+ DARL DGSR
Sbjct: 124 MVNGPDQVYVERDGKLVLTDVRFRDDEHVIHIIEKIVAPLGRRIDESSPMVDARLPDGSR 183

Query: 200 VNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGT 259
           VN IIPPLAL+GPT+TIRKF +D  T++ L+ FG +T E A+ L+    +R N++++GGT
Sbjct: 184 VNAIIPPLALNGPTITIRKFAEDPFTVEDLIGFGTMTEEMAQFLEACVEVRLNIVVAGGT 243

Query: 260 GSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVK 319
           GSGKTT LN L+ +I ++ERIVT ED AELQL Q HVV LETRPPN+EG+G +TMR+LVK
Sbjct: 244 GSGKTTTLNVLSSFIPEEERIVTIEDAAELQLVQDHVVSLETRPPNVEGKGAVTMRELVK 303

Query: 320 NCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFT 379
           N LRMRP+RI++GEVRG E LD+LQAMNTGHDGS+ T HAN+ R+   R+E M+ M G  
Sbjct: 304 NSLRMRPDRIVVGEVRGGEALDMLQAMNTGHDGSLTTGHANSPRDMLSRLETMVMMAGME 363

Query: 380 LPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDET 439
           LP + +R+ I S++D+IV   RLRDGSR+I  + E+ GMEG +I  QD+  +E  G D  
Sbjct: 364 LPVKAIRDQIASAVDLIVHQSRLRDGSRKIVKVTEVQGMEGEIITLQDIFSFEQEGFDNA 423

Query: 440 GKLIGQHISTGVSRPRFWNRAAQYG 464
           G + G+  +TG+ RP+F++R    G
Sbjct: 424 GNVQGELKATGI-RPKFFDRFKAEG 447


>gi|163742216|ref|ZP_02149604.1| type II/IV secretion system protein, TadA subfamily [Phaeobacter
           gallaeciensis 2.10]
 gi|161384546|gb|EDQ08927.1| type II/IV secretion system protein, TadA subfamily [Phaeobacter
           gallaeciensis 2.10]
          Length = 481

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/376 (52%), Positives = 272/376 (72%), Gaps = 5/376 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI+++  EI+  K I ++ +++  L ++L +++ G GPL+ L+  D + DI+VNG  +
Sbjct: 89  RAEISSIATEILEEKGIVLNREDRQTLTKELYDEVTGLGPLETLLQDDTVNDILVNGPQQ 148

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           VF+E +GK   + + F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 149 VFVERDGKLQLSDVTFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 208

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LVSFGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 209 VAVDGSLVSIRKFKKDKLGIDDLVSFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 268

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG GE++ RD +KN LRMRP
Sbjct: 269 LNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGRGEVSPRDCLKNALRMRP 328

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 329 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 388

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 389 SQIASAVNIIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPENKIIGHF 448

Query: 447 ISTGV-----SRPRFW 457
            +TGV      R R W
Sbjct: 449 TATGVRSHYSERFRLW 464


>gi|83950069|ref|ZP_00958802.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseovarius nubinhibens ISM]
 gi|83837968|gb|EAP77264.1| type II/IV secretion system protein, TadA subfamily protein
           [Roseovarius nubinhibens ISM]
          Length = 482

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/403 (48%), Positives = 282/403 (69%), Gaps = 5/403 (1%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E+K  +  +L++ ++++ L        R EI  +  E++  + I ++ +++  L ++L +
Sbjct: 65  EIKLEMHRSLLDNLNLSALETASEAELRAEIGAITGEVLEERSIILNREDRTTLVQELYD 124

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           ++ G GPL+ L+  D + DI+VNG +++F+E  GK   + + F+D   LL +  +IV+ V
Sbjct: 125 EVRGLGPLETLLKDDTVNDILVNGPHQIFVEREGKLQLSDVTFKDERHLLRIIDKIVSAV 184

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES+P  DARL DGSR N ++PP+A+DG  ++IRKFKKDKL +D LV FGA + E 
Sbjct: 185 GRRVDESNPYVDARLADGSRFNAMVPPVAVDGSLVSIRKFKKDKLGIDDLVKFGAFSEEM 244

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  LQ     R NV++SGGTGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+
Sbjct: 245 AAYLQAAVATRLNVIVSGGTGSGKTTTLNALSSFIDNSERILTIEDTAELQLQQTHVGRM 304

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E+RPPN+EG+GE++ RD +KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHA
Sbjct: 305 ESRPPNVEGKGEVSPRDCLKNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHA 364

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           NN R+   R+E M+AM G  +P + VR  I+S+++++VQ  RL+DGSRR+T+I EI GME
Sbjct: 365 NNPRDGISRLENMVAMAGMEMPLKAVRSQISSAVNLLVQASRLQDGSRRMTSITEITGME 424

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGV-----SRPRFW 457
           G+VI  Q++ +++ +G     K+IG   +TGV      R R W
Sbjct: 425 GDVISMQEVFRFQRVGLTPDNKIIGHFTATGVRSAYSERFRLW 467


>gi|170692561|ref|ZP_02883723.1| type II secretion system protein E [Burkholderia graminis C4D1M]
 gi|170142217|gb|EDT10383.1| type II secretion system protein E [Burkholderia graminis C4D1M]
          Length = 455

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/407 (45%), Positives = 279/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  +K  +   +++ +++ +L++  ++  R EI  L+  I+   K  ++  E+  L  D+
Sbjct: 33  YQTLKRKVHEAVLDRVELERLARLPAEQVRQEIGGLIARILEEDKAPVNDLERRQLTTDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN     ++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  HDEMFGFGPLEALLRDPTVSDILVNTHRTTYVERRGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +  LV+  ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAVDGPLMSIRRFAVNPLQMSDLVASQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I + ER+VT ED AELQL+Q HV+
Sbjct: 213 PMAELLDALTRAKVNVLVSGGTGSGKTTLLNILSGFIPEGERVVTIEDAAELQLRQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+T R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNVEGRGEVTQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G +LP + +R+ I+S++ V+VQ  RL DG R++ +I E+ G
Sbjct: 333 HANTPRDALTRLENMISLAGLSLPPKNLRQQISSAISVVVQVARLTDGRRKVVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG ++  Q++  ++  G D+ G + G   +TGV RP+F  R   +G
Sbjct: 393 MEGEMVNMQEIFTFKRTGVDQNGAVRGHFCATGV-RPKFTERLQAFG 438


>gi|116748935|ref|YP_845622.1| type II secretion system protein E [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697999|gb|ABK17187.1| type II secretion system protein E [Syntrophobacter fumaroxidans
           MPOB]
          Length = 468

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/405 (48%), Positives = 285/405 (70%), Gaps = 3/405 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLF 114
            YYE+K+ I   LI++ID++ L   D    + +I  L+  I+     +I ++L+E+  LF
Sbjct: 44  EYYELKTRIHDRLIDLIDLSLLDSLDVNVLKVQIRKLVERILLEEENQIPLNLNERDHLF 103

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ +++ G+GPL+P +    ++DI+VN   ++++E  GK   T   F+D+  L  +  +
Sbjct: 104 REIQDEVFGFGPLEPFLQDPTVSDILVNTYRQIYVERFGKLELTEARFKDDGHLRKIIDK 163

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+ VGRR+DESSP+ DARL DGSRVN IIPPL+L GP L+IR+F +D L +  L++   
Sbjct: 164 IVSAVGRRIDESSPMVDARLPDGSRVNAIIPPLSLGGPALSIRRFSRDPLEMGDLITLNT 223

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T E   +L+ I + R NVLISGGTGSGKTTLLN L+R+I ++ERIVT ED AELQL+Q 
Sbjct: 224 LTPEIGEVLKAIIKARLNVLISGGTGSGKTTLLNVLSRFIPEEERIVTIEDAAELQLKQT 283

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           H+VRLETRPPNIEG+GE+T R+LVKN LRMRP+RII+GEVRG E  D+LQAMNTGHDGS+
Sbjct: 284 HLVRLETRPPNIEGKGEVTQRELVKNTLRMRPDRIIVGEVRGQEAFDMLQAMNTGHDGSL 343

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN+ R++  R+E M+AM G  +P   +R  I S+++++ Q  RL DGSR++ ++ E
Sbjct: 344 TTIHANSPRDALMRLETMVAMAGLEIPGDFLRRYIASAINIVGQLSRLADGSRKLVSLQE 403

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
           I GMEG+++  Q++  +E  G D  GK+ G+  + G+ RP+F  +
Sbjct: 404 ITGMEGSMVTMQEIFTFEQTGIDAEGKVKGRFKACGI-RPKFVEK 447


>gi|300692334|ref|YP_003753329.1| Tad secretion sytem protein, secretion ATPase [Ralstonia
           solanacearum PSI07]
 gi|299079394|emb|CBJ52065.1| Tad secretion sytem protein, secretion ATPase [Ralstonia
           solanacearum PSI07]
          Length = 454

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/407 (48%), Positives = 281/407 (69%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y ++   I   +++ +++T+L Q   +  + E+A L+  I+      ++  E+  L  D+
Sbjct: 33  YQQLTMEIHQIIVDRVELTRLQQLTPEQVKRELAQLVERIIDEGNHQINEVERRRLVSDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LGYGPL+PL+A   ++DI+VN +  V++E  GK   T + F D+  L+ V +++V+
Sbjct: 93  QDEMLGYGPLEPLLADPTVSDILVNTAKCVYVERRGKLELTDVTFLDDAHLMRVIEKMVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSR+N IIPP A+DGP L+IR+F  + LT+  L+ F  +T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTMKDLIEFQTLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A+L + + + + NVLISGGTG GKTTLLN L+ YI  DERIVT ED AELQL Q HV+
Sbjct: 213 EMAQLFEAMVKAKLNVLISGGTGGGKTTLLNILSGYIPADERIVTIEDAAELQLLQNHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG GEIT R LVKN LRMRP+RII+GEVRGPE LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPANIEGRGEITQRSLVKNALRMRPDRIIVGEVRGPEALDMLHAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M++M G +LP + +R+ ITS+L V+VQ  RL DG R++ ++ EI G
Sbjct: 333 HANTPRDALTRLENMVSMAGLSLPPKTMRQQITSALSVVVQVSRLTDGRRKLISLQEITG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG V+   ++  +   G D  G++ G   +TGV RP+F  R   YG
Sbjct: 393 MEGEVVNMHEIFTFRRKGVDRDGRVHGHFCATGV-RPKFSERLHAYG 438


>gi|254512485|ref|ZP_05124552.1| type II secretion system protein E [Rhodobacteraceae bacterium
           KLH11]
 gi|221536196|gb|EEE39184.1| type II secretion system protein E [Rhodobacteraceae bacterium
           KLH11]
          Length = 479

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 276/383 (72%), Gaps = 5/383 (1%)

Query: 80  QYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADI 139
           + D    R EI+ + +E++  + I ++ +++  L ++L +++ G GPL+ L+  D + DI
Sbjct: 83  KADEAELRTEISAISSEVLEARNIVLNREDRTQLNKELYDEVTGLGPLETLLQDDTVNDI 142

Query: 140 MVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSR 199
           +VNG  ++F+E +GK   + I F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR
Sbjct: 143 LVNGPQQIFVERSGKLEISDITFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSR 202

Query: 200 VNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGT 259
            N ++PP+A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R N+++SGGT
Sbjct: 203 FNAMVPPIAVDGSLVSIRKFKKDKLGIDDLVNFGAFTEEMAAYLQAAVSTRLNIIVSGGT 262

Query: 260 GSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVK 319
           GSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +K
Sbjct: 263 GSGKTTTLNALSSFIDDAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLK 322

Query: 320 NCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFT 379
           N LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  
Sbjct: 323 NALRMRPDRIIVGETRGAEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIE 382

Query: 380 LPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDET 439
           +P + VR  I+S+++++VQ  RL+DGSRR+T+I EI GMEG+VI  Q++ K++ +G    
Sbjct: 383 MPIKAVRSQISSAVNLLVQASRLQDGSRRMTSITEITGMEGDVISMQEIFKFQRVGLTPD 442

Query: 440 GKLIGQHISTGV-----SRPRFW 457
            K+IG   +TGV      R R W
Sbjct: 443 NKIIGHFTATGVRSHYSERFRLW 465


>gi|253701802|ref|YP_003022991.1| type II secretion system protein E [Geobacter sp. M21]
 gi|251776652|gb|ACT19233.1| type II secretion system protein E [Geobacter sp. M21]
          Length = 437

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/409 (48%), Positives = 284/409 (69%), Gaps = 1/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+K+ I   LI+ ID+ ++    +     +I  ++  ++  + I ++  E+  L  ++
Sbjct: 22  FKEMKTRIHRRLIDSIDLAKMDLMRNSEMVSQIRGVIENLIVGEGIPLNQMERDRLVLEI 81

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G GPL+PL+A DDI+DI+VN S+ V+IE  GK  +T + FRDN  L+ + +RIV+
Sbjct: 82  QHETFGLGPLEPLLADDDISDILVNDSSNVYIEKGGKLQKTEVCFRDNAHLMQIIERIVS 141

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRR+DESSP  DARL DGSRVN IIPPLAL+GP L+IR+F  + L +  L+   A+  
Sbjct: 142 KIGRRIDESSPYVDARLPDGSRVNAIIPPLALNGPVLSIRRFGLEPLVMRDLLKLQALDQ 201

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL+   + R N+LISGGTG+GKTTLLN L+ +I   ER++T ED+AEL L+Q HVV
Sbjct: 202 RMAELLEAAVQTRLNILISGGTGTGKTTLLNVLSAFIPGGERLITIEDSAELHLKQEHVV 261

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+T RDL+KN LRMRP+RII+GEVRG E LDLLQAMNTGHDGS+ T+
Sbjct: 262 RLETRPPNLEGRGEVTSRDLLKNALRMRPDRIIIGEVRGGEALDLLQAMNTGHDGSLSTV 321

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G  LP + ++E + S+LD++VQ  R  DG+R++  + E+ G
Sbjct: 322 HANTTRDALSRLETMVLMAGLDLPERAIKEQMASALDLVVQLVRFSDGTRKVVKLSEVTG 381

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           MEGN I+  D++ ++  G D  G +IG+  +TGV RPRF  R   +G E
Sbjct: 382 MEGNTIVMHDVIVFQQKGIDRQGNVIGEFRATGV-RPRFAERFKLFGFE 429


>gi|323529410|ref|YP_004231562.1| type II secretion system protein E [Burkholderia sp. CCGE1001]
 gi|323386412|gb|ADX58502.1| type II secretion system protein E [Burkholderia sp. CCGE1001]
          Length = 455

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/407 (45%), Positives = 277/407 (68%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  +K  +   +++ +++ +L++  ++  R EI  L+  I+   K  ++  E+  L  D+
Sbjct: 33  YQTLKRKVHEAVLDRVELERLARLPTEQVRQEIGGLIARILEEDKAPVNDLERRQLTTDI 92

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+ L+    ++DI+VN     ++E  G+   T + F D+  L+ V ++IV+
Sbjct: 93  HDEMFGFGPLEALLRDPTVSDILVNTHRTTYVERRGRLELTDVTFYDDAHLMKVIEKIVS 152

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN IIPP A+DGP ++IR+F  + L +  L++  ++T 
Sbjct: 153 RVGRRIDESSPMVDARLPDGSRVNAIIPPSAVDGPLMSIRRFAVNPLQMSDLIASQSLTP 212

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL  + R + NVL+SGGTGSGKTTLLN L+ +I + ER+VT ED AELQL+Q HV+
Sbjct: 213 PMAELLDALTRAKVNVLVSGGTGSGKTTLLNILSGFIPEGERVVTIEDAAELQLRQHHVL 272

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+T R LV+N LRMRP+RIILGEVRG E LD+L AMNTGH+GS+ TI
Sbjct: 273 RLETRPPNVEGRGEVTQRTLVRNALRMRPDRIILGEVRGAEALDMLNAMNTGHEGSLATI 332

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E MI++ G  LP + +R+ I+S++ V+VQ  RL DG R++ +I E+ G
Sbjct: 333 HANTPRDALTRLENMISLAGLALPPKNLRQQISSAISVVVQVARLNDGRRKVVSIQELTG 392

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEG ++  Q++  +   G D+ G + G   +TGV RPRF  R   +G
Sbjct: 393 MEGEMVNMQEIFTFRRTGVDQNGAVRGHFCATGV-RPRFTERLQAFG 438


>gi|254474854|ref|ZP_05088240.1| type II secretion system protein E [Ruegeria sp. R11]
 gi|214029097|gb|EEB69932.1| type II secretion system protein E [Ruegeria sp. R11]
          Length = 485

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 276/378 (73%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI+++ +EI+  + I ++ +++  L ++L +++ G GPL+ L+  D ++DI+VNG  +
Sbjct: 93  RAEISSIASEILEERGIVLNREDRQTLNKELYDEVTGLGPLETLLQDDTVSDILVNGPQQ 152

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           VF+E  GK   + + F+D + L+ +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 153 VFVEREGKLQLSDVTFKDEKHLMRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 212

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           +A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R NV++SGGTGSGKTT 
Sbjct: 213 IAVDGSLVSIRKFKKDKLGIDDLVNFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGKTTT 272

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LRMRP
Sbjct: 273 LNALSSFIDNAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALRMRP 332

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P + VR
Sbjct: 333 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGISRLENMIAMAGIEMPIKAVR 392

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +++ +G     K+IG  
Sbjct: 393 SQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRFQRVGLTPDNKIIGHF 452

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  F  R   +G
Sbjct: 453 TATGV-RSHFSERFRLWG 469


>gi|110679393|ref|YP_682400.1| type II/IV secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455509|gb|ABG31714.1| type II/IV secretion system protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 485

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 270/379 (71%), Gaps = 5/379 (1%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI+ + +E +  + I ++ +++  L  +L +++ G GPL+ L+  D + DI+VNG
Sbjct: 87  QDLRQEISAITSEHLQAQSIVLNREDRQTLTSELYDEVTGLGPLETLLKDDSVNDILVNG 146

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++F+E +GK   T + F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 147 PQQIFVERDGKLQLTDVMFKDERHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAM 206

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R N+++SGGTGSGK
Sbjct: 207 VPPVAVDGSLVSIRKFKKDKLGIDDLVHFGAFTEEMAAYLQAAVATRLNIIVSGGTGSGK 266

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+GE++ RD +KN LR
Sbjct: 267 TTTLNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGEVSPRDCLKNALR 326

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 327 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPLK 386

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            VR  I S++++IVQ  RL+DGSRR+T+I E+ GMEG VI  Q++ +Y+ +G     K+I
Sbjct: 387 AVRSQIASAVNLIVQASRLQDGSRRMTSITEVTGMEGEVISMQEIFRYQRVGLTPENKII 446

Query: 444 GQHISTGV-----SRPRFW 457
           G + +TGV      R R W
Sbjct: 447 GHYTATGVRSAYAERFRMW 465


>gi|294139873|ref|YP_003555851.1| Flp pilus assembly protein TadA [Shewanella violacea DSS12]
 gi|293326342|dbj|BAJ01073.1| Flp pilus assembly protein TadA [Shewanella violacea DSS12]
          Length = 454

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/394 (48%), Positives = 269/394 (68%), Gaps = 5/394 (1%)

Query: 84  QSARDEIAT----LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADI 139
           Q +R+E+ T     + +I    ++ M   EQ  +   L +++LG GPLQ LI   DI DI
Sbjct: 59  QLSREELETRTFEAVGDIAQRHQLPMGGQEQKQIMLRLVDEMLGLGPLQVLIDDPDITDI 118

Query: 140 MVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSR 199
           MVNG  +VFIE  GK     I+FRD E +L++ +RIV+++GRR+DE++P+ DARL DGSR
Sbjct: 119 MVNGYKEVFIEHKGKLKSAEISFRDEEHVLNLARRIVSRIGRRIDETNPMVDARLPDGSR 178

Query: 200 VNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGT 259
           VNV+IPPLALDG  ++IRKF  +K +L  L   GA++A+   LL II R R NVLISGGT
Sbjct: 179 VNVLIPPLALDGTCISIRKFSHNKRSLSQLAELGAMSADMVTLLDIIARCRVNVLISGGT 238

Query: 260 GSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVK 319
           G+GKTTLLN ++     +ERI+T ED AEL+L QPHV+R+ETRP + EG   +  R L+K
Sbjct: 239 GAGKTTLLNAMSFGFSPEERIITIEDAAELKLAQPHVIRIETRPASSEGLEAVDQRRLLK 298

Query: 320 NCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFT 379
           N LRMRP+RIILGEVRG E  D++QAMNTGHDGSM T+HAN+  ++  R+E M+ M    
Sbjct: 299 NALRMRPDRIILGEVRGAEAFDMMQAMNTGHDGSMCTLHANSPSDALIRLENMLLMAEVN 358

Query: 380 LPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDET 439
           LP   +R  + S++D+IVQ +R+RDG RR+T+I E+VG+EG+  +T DL +++  G+D  
Sbjct: 359 LPPAALRRQVASTIDIIVQIERMRDGRRRVTHITELVGLEGDQYLTHDLFRFDYQGQDSQ 418

Query: 440 GKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           G ++GQ +      P+F  +A  Y  +  L +V+
Sbjct: 419 GNVLGQFLCAH-KVPKFIEKARYYQLDSRLKQVM 451


>gi|283852076|ref|ZP_06369350.1| type II secretion system protein E [Desulfovibrio sp. FW1012B]
 gi|283572466|gb|EFC20452.1| type II secretion system protein E [Desulfovibrio sp. FW1012B]
          Length = 456

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 209/409 (51%), Positives = 285/409 (69%), Gaps = 3/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLFE 115
           YYE+K+ I   LI++ID++ L   D  S   EI  L+  ++     +  ++  E+  L  
Sbjct: 33  YYEIKTRIHDRLIDLIDLSLLDTMDGASLGAEIGKLVERLLRDEFSQTPLNQVERERLIS 92

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           ++ +++LG GPL+P +    I DI+VN   ++++E +GK V T   F+DNE L  +  RI
Sbjct: 93  EVKDEMLGLGPLEPFLKDQTINDILVNSFRQIYVERSGKLVLTESRFKDNEHLKKIIDRI 152

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V++VGRRVDESSP+ DARL DGSRVN IIPPLA+DGP L+IRKF KDKLT++ L+ F A+
Sbjct: 153 VSKVGRRVDESSPMVDARLPDGSRVNAIIPPLAIDGPALSIRKFAKDKLTIEDLIHFRAM 212

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T + A +LQ I   R N+LISGGTG+GKTT+LNCL+ +I  DERIVT ED AELQL+Q H
Sbjct: 213 TRDIADVLQGIVLARLNILISGGTGTGKTTMLNCLSGFIPHDERIVTVEDAAELQLKQDH 272

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE+RPPNIEG GE+T RDLV+NCLRMRP+RII+GEVRG E LD+LQAMNTGHDGS+ 
Sbjct: 273 VVRLESRPPNIEGRGEVTQRDLVRNCLRMRPDRIIVGEVRGAEALDMLQAMNTGHDGSLA 332

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HAN  R++  R+E ++AM G  +    ++  I S++DVI+Q  R  DGSR++ +  E+
Sbjct: 333 TLHANTPRDALMRLETLVAMAGLAISPLSLKRYIASAVDVIIQISRFSDGSRKLVSFQEL 392

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            GMEG VI  Q++  +E  G    GK+ G  ++ G+ RP+F  R    G
Sbjct: 393 TGMEGEVITMQEIFAFEQRGMAADGKVKGVFMARGI-RPKFAARFEAKG 440


>gi|134299962|ref|YP_001113458.1| type II secretion system protein E [Desulfotomaculum reducens MI-1]
 gi|134052662|gb|ABO50633.1| type II secretion system protein E [Desulfotomaculum reducens MI-1]
          Length = 457

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 290/406 (71%), Gaps = 2/406 (0%)

Query: 60  EVKSTIFTTLIEMI-DITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           E+  T+   +I+ + DI +  +   ++   +I TL+N+++   +  ++  ++  +  ++ 
Sbjct: 40  ELTLTLHKKVIDKLKDIPEDVKDHPETLAKKIETLVNDLLDEGEENVARPQRQMIVAEII 99

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           ++ +G+GP+  L+    I+++MVNG +++++E +GK + TG+NFRDN  +L +  +IV  
Sbjct: 100 DETIGFGPITTLLNDPSISEVMVNGPDQIYVERDGKLILTGVNFRDNAHVLHIIDKIVAP 159

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           +GRR+DES P+ DARL DGSRVN IIPPLAL+GPT+TIRKF KD  T+D L++FG +T +
Sbjct: 160 IGRRIDESMPMVDARLPDGSRVNAIIPPLALNGPTITIRKFSKDPYTVDDLINFGTLTPQ 219

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   + R N+++SGGTGSGKTT LN L+ +I  DERIVT ED AELQL+Q HV+ 
Sbjct: 220 MAQFVEACVKARLNIVVSGGTGSGKTTTLNVLSSFIPPDERIVTIEDAAELQLRQEHVIT 279

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LE+RPPNIEG+G IT+RDLV+N LRMRPERI++GEVR  E LD+LQAMNTGHDGS+ T H
Sbjct: 280 LESRPPNIEGKGAITIRDLVRNSLRMRPERIVVGEVRSGEALDMLQAMNTGHDGSLTTGH 339

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R+   R+E M+ M G  LP + +RE I+S++D+I+Q  RL+DGSR+IT+I E+ GM
Sbjct: 340 ANTPRDMLSRLETMVLMAGMDLPIRAIREQISSAIDLIIQQSRLKDGSRKITHITEVQGM 399

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EG VII QDL  +   G DE GK+ G   STG+ RP+F ++    G
Sbjct: 400 EGEVIILQDLFVFHQTGLDENGKVKGTFHSTGI-RPKFTSQLETIG 444


>gi|156743184|ref|YP_001433313.1| type II secretion system protein E [Roseiflexus castenholzii DSM
           13941]
 gi|156234512|gb|ABU59295.1| type II secretion system protein E [Roseiflexus castenholzii DSM
           13941]
          Length = 478

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 258/362 (71%), Gaps = 1/362 (0%)

Query: 103 ITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINF 162
           + ++ D+   L++ + +++ G+GP++PL+  D I ++MVNG   V++E  GK   T + F
Sbjct: 99  VNLTDDQTKHLYDMVMDELFGFGPIEPLLRDDSITEVMVNGPRAVYVEQKGKITLTQVRF 158

Query: 163 RDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKD 222
            ++E +L V  RI+  +GRR+D   P+ DARL DGSRVN IIPP A+DGP++TIRKF K 
Sbjct: 159 ANDEHVLKVIDRIIRPLGRRIDRKWPMVDARLPDGSRVNAIIPPCAIDGPSITIRKFAKK 218

Query: 223 KLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVT 282
           KLT++ L+ FG++T E A  L+     R N+++SGGTGSGKTTLLN L+ +I  DERIVT
Sbjct: 219 KLTVEDLIRFGSMTPEMAEFLRACVVSRLNIIVSGGTGSGKTTLLNVLSNFIPPDERIVT 278

Query: 283 CEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDL 342
            ED+AEL+L Q HVVRLE++PP I+G G +T+ DLV N LRMRPERI++GE RG E + +
Sbjct: 279 IEDSAELKLGQDHVVRLESKPPEIDGTGRVTINDLVINSLRMRPERIVIGECRGGETMAM 338

Query: 343 LQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRL 402
           LQAMNTGHDGS+ T+HAN+ R++  RME M  M G  +P +++RE I S++D+IVQ  RL
Sbjct: 339 LQAMNTGHDGSLSTLHANSPRDAIARMETMAMMAGMDMPLRVIREQIASAIDLIVQQTRL 398

Query: 403 RDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQ 462
            DGSR+I+ I E+ GMEG+V++ QD+    ++G+   GK+I +   TG +RPRF  R   
Sbjct: 399 EDGSRKISYITEVQGMEGDVVVLQDIFLLHILGKTPEGKIISELRPTG-TRPRFTARLEA 457

Query: 463 YG 464
           +G
Sbjct: 458 HG 459


>gi|224824218|ref|ZP_03697326.1| type II secretion system protein E [Lutiella nitroferrum 2002]
 gi|224603637|gb|EEG09812.1| type II secretion system protein E [Lutiella nitroferrum 2002]
          Length = 452

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 285/407 (70%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y+++K+ I   L++ +D+T +        +DE+  L+  ++S +   ++  E+ +L  D+
Sbjct: 32  YHDLKARIHQKLLDRVDLTVMESLTPDRLKDELKILVERLLSEENTALNETERRNLVRDI 91

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GPL+PL+A   I+DI+VN   +++IE  GK   T I F D+  L+ +  +IV+
Sbjct: 92  QHEMLGLGPLEPLLADPTISDILVNTYQQIYIERRGKLELTDIRFNDDAHLMKIIDKIVS 151

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRRVDESSP+ DARL DGSRVN IIPPLA+DGP ++IR+F    L +D ++ + ++T 
Sbjct: 152 RVGRRVDESSPMVDARLPDGSRVNAIIPPLAIDGPIMSIRRFAAVPLRMDDIIEYKSLTP 211

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + A +L+ + + + N+LISGGTGSGKTT+LN L+ +I + ERI+T ED AELQLQQPH++
Sbjct: 212 DMATVLKGLAKAKMNMLISGGTGSGKTTMLNILSGFIPEVERIITIEDAAELQLQQPHII 271

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPNIEG GE+  R LV+N LRMRP+RIILGEVRG E LD+LQAMNTGH+GSM TI
Sbjct: 272 RLETRPPNIEGRGEVPQRALVRNSLRMRPDRIILGEVRGAEALDMLQAMNTGHEGSMATI 331

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  R+E M+ M G  LP +++R+ I+S++ VI+Q  RL DG R++ +I EI G
Sbjct: 332 HANTPRDAITRLENMVGMAGMNLPPKVIRQQISSAISVIIQIARLTDGKRKVVSIQEITG 391

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            EG+VI  Q+L  Y   G    G + G   +TGV RP+F +R   +G
Sbjct: 392 TEGDVITMQELFHYVQTGIGMDGAVQGYFCATGV-RPKFIDRLKTHG 437


>gi|126725973|ref|ZP_01741815.1| type II/IV secretion system protein, TadA subfamily
           [Rhodobacterales bacterium HTCC2150]
 gi|126705177|gb|EBA04268.1| type II/IV secretion system protein, TadA subfamily
           [Rhodobacterales bacterium HTCC2150]
          Length = 478

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/378 (51%), Positives = 272/378 (71%), Gaps = 1/378 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R EI ++  E +    + ++ DE+  L  +L +++ G GPL+PL+  D IADI++NG   
Sbjct: 88  RQEIISISAETLDNLGVVLNKDERTTLHSELYDEVTGLGPLEPLLKDDSIADILINGPKN 147

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           +F+E NGK  ++ I FR+ + LL +  +IV+ VGRRVDES+P  DARL DGSR N ++PP
Sbjct: 148 IFVERNGKLTKSEITFRNEKHLLRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAMVPP 207

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           + +DG  ++IRKFKKDKL +  LV+FGA + E A  L+     R NV++SGGTGSGKTT 
Sbjct: 208 IGVDGSLVSIRKFKKDKLGISDLVNFGAFSPEMALYLEAAVATRLNVIVSGGTGSGKTTT 267

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I  DERI+T EDTAELQLQQ HV R+E+RP N+EG+GE++ RD ++N LRMRP
Sbjct: 268 LNALSSFIANDERILTIEDTAELQLQQEHVGRMESRPANVEGKGEVSQRDCLRNALRMRP 327

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RII+GE RG EV+D+LQAMNTGHDGSM TIHANNAR+   R+E MIAM G  +P + +R
Sbjct: 328 DRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANNARDGVSRLENMIAMSGIDMPLRAMR 387

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I++++++IVQ  RL+DGSRR+ +I EI GMEG++I  Q++ +Y+ +G    GK+IG  
Sbjct: 388 SQISAAVNLIVQVSRLQDGSRRMVSITEITGMEGDIISMQEVFRYQRVGLGPGGKIIGHF 447

Query: 447 ISTGVSRPRFWNRAAQYG 464
            +TGV R  +  R  Q+G
Sbjct: 448 TATGV-RSHYAERFKQWG 464


>gi|84516636|ref|ZP_01003995.1| type II/IV secretion system protein, TadA subfamily [Loktanella
           vestfoldensis SKA53]
 gi|84509672|gb|EAQ06130.1| type II/IV secretion system protein, TadA subfamily [Loktanella
           vestfoldensis SKA53]
          Length = 479

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 293/446 (65%), Gaps = 5/446 (1%)

Query: 23  QEVVVSSSNIQKQNLQSS----SPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQL 78
           Q  V S+ N    +L  +     P+  G       R     E+K  +  +L+E +++  L
Sbjct: 21  QRAVASAPNPDSPSLMKAMPQRRPADAGPADKDKRRKDRLQELKLDLHKSLLENLNLAAL 80

Query: 79  SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIAD 138
                Q  R EI  + NE +    + +S +E+  L +DL  ++ G GPL+ L+  D I D
Sbjct: 81  ETATEQELRTEINAIANETLEEMGVVLSREERQTLSQDLFFEVTGLGPLETLLKDDTIND 140

Query: 139 IMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGS 198
           I+VNG  ++F+E NGK   T + F+D   LL +  +IV+ VGRRVDES+P  DARL DGS
Sbjct: 141 ILVNGPQQIFVERNGKLELTDVTFKDERHLLRIIDKIVSAVGRRVDESNPYVDARLADGS 200

Query: 199 RVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGG 258
           R N ++PP+A+DG  ++IRKFKKDKL +D LV FGA T E A  LQ     R N+++SGG
Sbjct: 201 RFNAMVPPIAVDGSLVSIRKFKKDKLGVDDLVRFGAFTEEMAAYLQAAVSTRLNIIVSGG 260

Query: 259 TGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLV 318
           TGSGKTT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G ++ RD +
Sbjct: 261 TGSGKTTTLNALSGFIDDAERILTIEDTAELQLQQTHVGRMESRPPNVEGKGGVSQRDCL 320

Query: 319 KNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGF 378
           KN LRMRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G 
Sbjct: 321 KNALRMRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGI 380

Query: 379 TLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDE 438
            +P + +R  I S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +Y+ +G   
Sbjct: 381 DMPIKAMRSQIASAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRYQRVGLTP 440

Query: 439 TGKLIGQHISTGVSRPRFWNRAAQYG 464
             K+IG   +TGV R  F  R   +G
Sbjct: 441 DNKIIGHFTATGV-RSHFSERFKLWG 465


>gi|197117444|ref|YP_002137871.1| Flp pilus assembly ATPase CpaF [Geobacter bemidjiensis Bem]
 gi|197086804|gb|ACH38075.1| Flp pilus assembly ATPase CpaF [Geobacter bemidjiensis Bem]
          Length = 437

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/409 (48%), Positives = 282/409 (68%), Gaps = 1/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+K+ I   LI+ ID+ ++    +     +I  ++  ++  + + ++  E+  L  ++
Sbjct: 22  FKEMKTRIHRRLIDSIDLAKMDLMRNNEMVSQIRGVIENLIVGEGVPLNQMERDRLVLEI 81

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++  G GPL+PL+A D I+DI+VN S+ V+IE  GK  +T + FRDN  L+ + +RIV+
Sbjct: 82  QHETFGLGPLEPLLADDQISDILVNDSSNVYIEKGGKLQKTEVCFRDNAHLMQIIERIVS 141

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           ++GRR+DESSP  DARL DGSRVN IIPPLAL+GP L+IR+F  + L +  L+   A+  
Sbjct: 142 KIGRRIDESSPYVDARLPDGSRVNAIIPPLALNGPVLSIRRFGLEPLVMRDLIKLQALDQ 201

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A LL+   + R N+LISGGTG+GKTTLLN L+ +I   ER++T ED+AEL L+Q HVV
Sbjct: 202 RMAELLEAAVQTRLNILISGGTGTGKTTLLNVLSAFIPGGERLITIEDSAELNLKQEHVV 261

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRPPN+EG GE+T RDL+KN LRMRP+RII+GEVRG E LDLLQAMNTGHDGS+ T+
Sbjct: 262 RLETRPPNLEGRGEVTSRDLLKNALRMRPDRIIIGEVRGGEALDLLQAMNTGHDGSLSTV 321

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  RME M+ M G  LP + ++E + S+LD++VQ  R  DG+R++  + EI G
Sbjct: 322 HANTTRDALSRMETMVLMAGLDLPERAIKEQMASALDLVVQLVRFSDGTRKVVKLSEITG 381

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           MEGN I+  D++ +   G D  G +IG+  +TGV RPRF  R   YG E
Sbjct: 382 MEGNTIVMHDIIVFLQKGIDRQGNVIGEFRATGV-RPRFAERFKLYGFE 429


>gi|148656010|ref|YP_001276215.1| type II secretion system protein E [Roseiflexus sp. RS-1]
 gi|148568120|gb|ABQ90265.1| type II secretion system protein E [Roseiflexus sp. RS-1]
          Length = 477

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/358 (50%), Positives = 257/358 (71%), Gaps = 2/358 (0%)

Query: 108 DEQL-DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNE 166
           DEQ   L++ + +++ G+GP++PL+  D I+++MVNG   V++E  GK   T + F ++E
Sbjct: 102 DEQTRQLYDMVMDELFGFGPIEPLLRDDSISEVMVNGPRSVYVEQKGKLTLTSVRFANDE 161

Query: 167 QLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTL 226
            +L V  RI+  +GRR+D   P+ DARL DGSRVN IIPP A+DGP++TIRKF K KLT+
Sbjct: 162 HVLKVIDRIIRPLGRRIDRKWPMVDARLPDGSRVNAIIPPCAIDGPSITIRKFAKKKLTV 221

Query: 227 DHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT 286
           + L+ FG++T E A  L+     R N++++GGTGSGKTTLLN L+ +I  DERIVT ED+
Sbjct: 222 EDLIRFGSMTPEMAEFLRACVVSRLNIIVAGGTGSGKTTLLNVLSNFIPPDERIVTIEDS 281

Query: 287 AELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAM 346
           AEL+L Q HVVRLE++PP I+G G +T+ DLV N LRMRPERI++GE RG E + +LQAM
Sbjct: 282 AELKLAQEHVVRLESKPPEIDGTGRVTINDLVINSLRMRPERIVIGECRGGETMAMLQAM 341

Query: 347 NTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS 406
           NTGHDGS+ T+HAN+ R++  RME M  M G  +P +++RE I S++D+IVQ  RL DGS
Sbjct: 342 NTGHDGSLSTLHANSPRDAIARMETMAMMAGMDIPLRVIREQIASAIDLIVQQTRLEDGS 401

Query: 407 RRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           R+I  I E+ GMEG+V++ QD+   +++G+   GK+I +   TG +RPRF  R   +G
Sbjct: 402 RKIAYITEVQGMEGDVVVLQDIFVLQILGKTPEGKIISELRPTG-TRPRFTPRLEAHG 458


>gi|251791988|ref|YP_003006708.1| TadA [Aggregatibacter aphrophilus NJ8700]
 gi|11276039|gb|AAG33866.1|AF317389_1 putative type IV NTPase [Aggregatibacter aphrophilus]
 gi|247533375|gb|ACS96621.1| TadA [Aggregatibacter aphrophilus NJ8700]
          Length = 426

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 272/391 (69%), Gaps = 6/391 (1%)

Query: 88  DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           +E+  ++N + S     ++  + L + E + ++I GYGPL+ L+A D I DI+VNG + V
Sbjct: 35  NELVQIVNRVASKSGTYLTSADTLVMAEIVADEIEGYGPLRDLMADDTINDILVNGPDDV 94

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           +IE  G   +T   F  NEQL  + +R+V +VGRR+D+ SP+ D+RL DGSR+NV+I P+
Sbjct: 95  WIERAGILEKTSKEFVSNEQLTDIAKRLVARVGRRIDDGSPLVDSRLPDGSRLNVVIAPI 154

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           ALDG +++IRKF K+K TL  LV+FG++T E A  L I  R R N+++SGGTGSGKTTLL
Sbjct: 155 ALDGTSVSIRKFSKNKKTLQELVNFGSMTREMANFLIIAARSRVNIIVSGGTGSGKTTLL 214

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           N L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +E  GE+TM+DLV N LRMRPE
Sbjct: 215 NALSNYISHSERVITLEDTAELRLEQPHVVRLETRLAGVEHTGEVTMKDLVINALRMRPE 274

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E+M+ M   TLP + +R 
Sbjct: 275 RIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLESMVMMSNATLPLEAIRR 334

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMG-EDETGKLIGQH 446
            I S++++IVQ  RL DGSR+I NI EI+GME   I+ QD+  Y+     D+ GK++G+ 
Sbjct: 335 NIASAVNIIVQASRLNDGSRKIVNITEIMGMENGQIVLQDIFSYKASKYRDKNGKILGEF 394

Query: 447 ISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           ++ G ++R   +  A  +    NL+  LQS+
Sbjct: 395 VNHGLLTRSIVYQNAQVF----NLSAELQSI 421


>gi|319940443|ref|ZP_08014788.1| type II secretion system protein E [Sutterella wadsworthensis
           3_1_45B]
 gi|319806069|gb|EFW02818.1| type II secretion system protein E [Sutterella wadsworthensis
           3_1_45B]
          Length = 494

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/405 (47%), Positives = 277/405 (68%), Gaps = 2/405 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           V+ TI   +   ID  + +    ++  +++A L+ EI    +  ++  E+  +   + ++
Sbjct: 89  VRRTIHDQVFAQIDPMKAATTSRENLAEQVAQLIREICDQNRFQLTAAEEQAISAQMLDE 148

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           +LG GP++PL+A + + DI+VNG++KVF+E  GK   T I F D E + ++ QRI  +VG
Sbjct: 149 MLGIGPIEPLLADETVTDILVNGADKVFVERFGKLELTPITFIDEEHVFNIAQRIAARVG 208

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DE++P+ DARL DGSRVNV+  PLALDG +++IRKF K K  L+ L   GA+T E  
Sbjct: 209 RRIDEANPMVDARLADGSRVNVVTKPLALDGTSISIRKFSKHKRNLEELSEGGALTKEMV 268

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
            LL      R N+++SGGTG+GKTTLLN L+  I + ER+VT ED AELQL Q  +VRLE
Sbjct: 269 ELLSRAVMARLNIVVSGGTGAGKTTLLNALSFKIGQKERVVTIEDAAELQLNQEDIVRLE 328

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP +IEG G+IT RDLVKN LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+HAN
Sbjct: 329 TRPESIEGGGQITQRDLVKNALRMRPDRIILGEVRGGECFDMLQAMNTGHDGSLCTVHAN 388

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           NAR++  R+E M+ M    LP   +R  I  +++++VQ +R+RDG RR+ +I E+ GME 
Sbjct: 389 NARDALIRLENMVLMANLQLPLNAIRRQIGGAVNMVVQIERMRDGKRRVVSIVEVCGMEE 448

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW-NRAAQYG 464
           +VI TQ+L  Y +      G+++G+ ++TG+ RP+F+ +RA  +G
Sbjct: 449 DVIQTQELYNYRIKSISADGRIVGEFVNTGL-RPKFYQDRAHLFG 492


>gi|325964124|ref|YP_004242030.1| Flp pilus assembly protein, ATPase CpaF [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323470211|gb|ADX73896.1| Flp pilus assembly protein, ATPase CpaF [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 495

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/372 (50%), Positives = 273/372 (73%), Gaps = 2/372 (0%)

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           +  I+  +++ +S +E+  L  D+ +D+LGYGPLQ L+   D+++IMVN  +++++E  G
Sbjct: 108 LTRIIDAEQVPLSPEERTRLVRDVADDVLGYGPLQRLLDDPDVSEIMVNRMDQIYVERKG 167

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           K   +   F   E L  V +RIV++VGRR+DESSP+ DARL DGSRVN +IPPLA+ G +
Sbjct: 168 KLTLSESRFSSEEHLRKVIERIVSKVGRRIDESSPLVDARLEDGSRVNAVIPPLAVGGSS 227

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           LTIRKF K  LT+ +L+SFG +T E A LL    + + N+++SGGTG+GKTTLLN L+ +
Sbjct: 228 LTIRKFSKTPLTVQNLISFGTLTPEMAELLNACVKAKLNIIVSGGTGTGKTTLLNVLSSF 287

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           +  DERIVT ED  ELQ+QQ HVVRLE+RPPN EG+GE+T+R+L++N LRMRP+RI++GE
Sbjct: 288 LPSDERIVTIEDAVELQIQQEHVVRLESRPPNTEGKGEVTIRELLRNSLRMRPDRIVVGE 347

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
           VRG E LD+LQAMNTGHDGS+ T+H+N+ R++  R+E ++ M G  LP + +RE I S++
Sbjct: 348 VRGGESLDMLQAMNTGHDGSLSTVHSNSPRDAVARLETLVLMAGMDLPLRAIREQIASAV 407

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQHISTGVS 452
           ++IVQ  RLRDGSRRIT++ E+ GMEG+++  QD   ++   G D  G+ +G+ ++TG+ 
Sbjct: 408 NLIVQISRLRDGSRRITHVTEVQGMEGDIVTLQDAFVFDYSAGVDSHGRFLGKPVATGI- 466

Query: 453 RPRFWNRAAQYG 464
           RPRF +R    G
Sbjct: 467 RPRFIDRFEDLG 478


>gi|126733576|ref|ZP_01749323.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. CCS2]
 gi|126716442|gb|EBA13306.1| type II/IV secretion system protein, TadA subfamily [Roseobacter
           sp. CCS2]
          Length = 486

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 202/381 (53%), Positives = 269/381 (70%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI  + NE +    I ++ DE+  L +DL  ++ G GPL+ L+  D + DI+VNG
Sbjct: 93  QELRTEINAIANETLEDMGIVLNRDERQTLSQDLFFEVTGLGPLETLLKDDTVNDILVNG 152

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
             ++F+E +G    T I F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 153 PQQIFVERDGNLELTDITFKDERHLLRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAM 212

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL ++ LV FGA T E A  LQ     R NV++SGGTGSGK
Sbjct: 213 VPPIAVDGSLVSIRKFKKDKLGIEELVKFGAFTEEMAAYLQAAVSTRLNVIVSGGTGSGK 272

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID DERI+T EDTAELQLQQ HV R+E+RPPN+EG G ++ RD +KN LR
Sbjct: 273 TTTLNALSGFIDDDERILTIEDTAELQLQQTHVGRMESRPPNVEGRGGVSQRDCLKNALR 332

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MIAM G  +P +
Sbjct: 333 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSARDGVSRLENMIAMAGIEMPIK 392

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            +R  I+S++++IVQ  RL+DGSRR+T+I EI GMEG+VI  Q++ +Y+ +G     K+I
Sbjct: 393 AMRSQISSAVNLIVQASRLQDGSRRMTSITEITGMEGDVISMQEIFRYQRVGLTPDNKII 452

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G   +TGV R  F  R   +G
Sbjct: 453 GHFTATGV-RSHFSERFKLWG 472


>gi|220913384|ref|YP_002488693.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
 gi|219860262|gb|ACL40604.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
          Length = 491

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 210/469 (44%), Positives = 305/469 (65%), Gaps = 24/469 (5%)

Query: 10  MGSVKREDNNPL-PQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYY--------- 59
           M + + E  NP  PQ   V  + + + +   S+     E+   V  TP            
Sbjct: 17  MSAAEPEQKNPFAPQPAPVEPATLGRIHEAKSA-----EVAEVVELTPTAAVASGALSAL 71

Query: 60  --EVKSTIFTTLIEMIDITQLSQYD-SQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
                 +++  L   I  + L + +  Q  +DE+  +++E    +++ ++  E+  L  +
Sbjct: 72  KERASQSLYERLGARITDSSLEEAELHQYVKDELKIVVDE----EQVPLTSAERQRLIRE 127

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + +D+LG+GP+Q  +    I ++MVN  ++V+IE  GK   T   F  +E L  V +RIV
Sbjct: 128 IIDDVLGHGPIQRFLDDPSITEVMVNRFDQVYIERAGKLTLTDTKFSSDEALRRVIERIV 187

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           ++VGRR+DESSP+ DARL DGSRVN IIPPLA++GP LTIRKF  D LT+D L++FG+++
Sbjct: 188 SKVGRRIDESSPLVDARLADGSRVNAIIPPLAVNGPALTIRKFGGDALTVDKLIAFGSLS 247

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            E A LLQ     R N+++SGGTG+GKTTLLN L+ +I   +RIVT ED  ELQLQQ HV
Sbjct: 248 PEMAELLQACVLARMNIIVSGGTGTGKTTLLNALSSFIPTSDRIVTIEDAVELQLQQDHV 307

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLE+RP NIEG+GEI +RDLV+N LRMRP+RI++GEVRG E LD+LQAMNTGHDGS+ T
Sbjct: 308 VRLESRPANIEGKGEIAIRDLVRNSLRMRPDRIVVGEVRGGECLDMLQAMNTGHDGSLST 367

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ R++  R+E ++ M G  LP + VRE + S++++IV   RLRDG+RR+T++ E+ 
Sbjct: 368 VHANSPRDAIARLETLVLMAGMDLPLRAVREQVASAVNLIVHISRLRDGTRRVTHVTEVQ 427

Query: 417 GMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           GMEG+++  QD   ++   G D TG+ +G+ + TGV RPRF +R A  G
Sbjct: 428 GMEGDIVTLQDAFVFDYAAGIDSTGRFLGKPVPTGV-RPRFTDRFADLG 475


>gi|90406747|ref|ZP_01214940.1| Flp pilus assembly protein TadA [Psychromonas sp. CNPT3]
 gi|90312200|gb|EAS40292.1| Flp pilus assembly protein TadA [Psychromonas sp. CNPT3]
          Length = 455

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/378 (50%), Positives = 259/378 (68%), Gaps = 1/378 (0%)

Query: 96  EIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKT 155
           EI    +  +   EQ  + + L N++LG GPLQ L+   D+ DIMVNG N+VFIE +GK 
Sbjct: 75  EIAYQHQFPIGAQEQKKISDQLVNEMLGLGPLQCLLDDPDVTDIMVNGPNEVFIETHGKL 134

Query: 156 VETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLT 215
             T I FR+ + LL++ +RIV+ VGRR+DESSP+ DARL DGSRVN++IPPLAL+G  ++
Sbjct: 135 KRTDIRFRNEDHLLNLARRIVSGVGRRIDESSPMVDARLADGSRVNILIPPLALNGTCIS 194

Query: 216 IRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYID 275
           IRKF  +K +L  L + GA++ E A LL +I R R NVLISGGTG+GKTTLLN ++  I 
Sbjct: 195 IRKFSDNKHSLQQLAALGAMSDEMASLLDVIARCRVNVLISGGTGAGKTTLLNAISFGIS 254

Query: 276 KDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVR 335
            DERI+T ED AEL+L QPHVV +ETRP N+EG   I    L+KN LRMRP+RIILGE+R
Sbjct: 255 PDERIITIEDAAELKLMQPHVVSIETRPSNMEGLVAIDQSILLKNALRMRPDRIILGEIR 314

Query: 336 GPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDV 395
           G E  D++QAMNTGHDGSM T+HAN+  ++  R+E M+ M    LP   +R  I S++++
Sbjct: 315 GAEAFDMMQAMNTGHDGSMCTLHANSPIDALIRLENMLLMSEAQLPLTALRRQIASTINI 374

Query: 396 IVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPR 455
           ++Q +R+RDG RR+ NI E+VG+EG   ++QDL  +E   +D  G + GQ I +  + PR
Sbjct: 375 VIQIERMRDGKRRVVNITELVGLEGEQYLSQDLFHFEKQSQDLEGNISGQFICSK-TLPR 433

Query: 456 FWNRAAQYGEEKNLAEVL 473
           F  +A  Y   K L   +
Sbjct: 434 FAEKAHYYNLTKQLKSAM 451


>gi|197118217|ref|YP_002138644.1| Flp pilus assembly ATPase CpaF [Geobacter bemidjiensis Bem]
 gi|197087577|gb|ACH38848.1| Flp pilus assembly ATPase CpaF [Geobacter bemidjiensis Bem]
          Length = 437

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/410 (48%), Positives = 280/410 (68%), Gaps = 1/410 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +P + E+KS I   LI+ ID+++L    +     EI  ++  ++  + + +S  E+  L 
Sbjct: 18  SPSFQELKSRIHRLLIDRIDLSKLELLRAGELEREIGAVIERLIVEEGVPLSRQEKESLV 77

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ ++  G GP++PL++  DI+DI+VN  +  ++E NGK  +T I FRDN  L  + +R
Sbjct: 78  LEVQHETFGLGPIEPLLSSPDISDILVNNCSNTYVERNGKLEKTNIVFRDNNHLRQIIER 137

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV +VGRR+DESSP  DARL DGSRVN IIPPLALDGP L+IR+F    L ++ L++ G 
Sbjct: 138 IVTRVGRRIDESSPFVDARLPDGSRVNAIIPPLALDGPALSIRRFGLVPLKMNDLLALGT 197

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +    A L++   + R N+LI GGTG+GKTTLLN ++ +I ++ERI+T ED+AELQL+Q 
Sbjct: 198 LDLRLATLIEGAVKTRMNILICGGTGTGKTTLLNVISEFIPENERILTIEDSAELQLKQD 257

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRPPNIEG G++T RDLV+N LRMRP RIILGEVRG E LD+LQAMNTGHDGS+
Sbjct: 258 HVVRLETRPPNIEGAGQVTQRDLVRNALRMRPNRIILGEVRGAEALDMLQAMNTGHDGSI 317

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIH+N  R++  R+  M+ M G  LP + ++E I S++++I+   R  DG+RRI    E
Sbjct: 318 STIHSNTVRDALSRLSTMVMMAGMELPDRAIKEQIASAINIIIHLVRFPDGTRRIVKFSE 377

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           I GMEG  I+ QD++ +E MG D  G++ G+   TGV RPR   R   +G
Sbjct: 378 ITGMEGETIVMQDIVCFEQMGVDRDGRVQGRFRGTGV-RPRLAERLKIHG 426


>gi|261867452|ref|YP_003255374.1| TadA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412784|gb|ACX82155.1| TadA [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|307133499|dbj|BAJ19011.1| TadA [Aggregatibacter actinomycetemcomitans]
          Length = 426

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/408 (47%), Positives = 282/408 (69%), Gaps = 8/408 (1%)

Query: 73  IDITQLSQYDSQ--SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           +DI ++ +  S+  S  +E+  ++N + +     ++  + L + E + ++I GYGPL+ L
Sbjct: 18  LDIEKIDELQSERSSLVNELVQIVNRVANKSGAYLTSADTLVMAEIVADEIEGYGPLRDL 77

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +A D I DI+VNG N +++E  G   +T   F  NEQL  + +R+V +VGRR+D+ SP+ 
Sbjct: 78  MADDTINDILVNGPNDIWVERAGILEKTDKEFVSNEQLTDIAKRLVARVGRRIDDGSPLV 137

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           D+RL DGSR+NV+I P+ALDG +++IRKF K+K TL  LV+FG++T E A  L I  R R
Sbjct: 138 DSRLPDGSRLNVVIAPIALDGTSISIRKFSKNKKTLQELVNFGSMTREMANFLIIAARSR 197

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +E  G
Sbjct: 198 VNIIVSGGTGSGKTTLLNALSNYISHTERVITLEDTAELRLEQPHVVRLETRLAGVEHTG 257

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
           E+TM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E
Sbjct: 258 EVTMQDLVINALRMRPERIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLE 317

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
           +M+ M   +LP + +R  I+S++++IVQ  RL DGSR+I NI E++GME   I+ QD+  
Sbjct: 318 SMVMMSNASLPLEAIRRNISSAVNIIVQASRLNDGSRKIMNITEVMGMENGQIVLQDIFS 377

Query: 431 YEVMG-EDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           Y+     D+ GK++G+ I+ G ++R   +  A  +    NL+  LQS+
Sbjct: 378 YKASKYRDKEGKILGEFINHGLLTRSAVFQNAQVF----NLSAELQSI 421


>gi|119773846|ref|YP_926586.1| type II/IV secretion system protein E [Shewanella amazonensis SB2B]
 gi|119766346|gb|ABL98916.1| type II/IV secretion system protein E [Shewanella amazonensis SB2B]
          Length = 589

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 257/356 (72%), Gaps = 4/356 (1%)

Query: 105 MSLDEQL---DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGIN 161
           M+L E +   DL  ++ ++ +G GPL+ LIA  D+ +IMVN  +++F E +G+   + I+
Sbjct: 213 MALPETIAATDLIREVLDETIGLGPLEALIADADVTEIMVNSHDQIFFEKSGQLYLSDIS 272

Query: 162 FRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKK 221
           F D++ +L   +RIV  +GRR+DE SP+ DARL DGSRVN +IPPLAL GP +TIRKF +
Sbjct: 273 FSDDQAVLGAIERIVAPIGRRIDEGSPMVDARLKDGSRVNAVIPPLALKGPCITIRKFMQ 332

Query: 222 DKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIV 281
            +L    LV FG+++   A  L++  + +CNV+ISGGTGSGKTTLLN L+ +I +DERI+
Sbjct: 333 RRLGASDLVGFGSMSQHMADFLEMAVKQKCNVVISGGTGSGKTTLLNVLSNFIPEDERII 392

Query: 282 TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLD 341
           T ED AEL+L QP++V LE RPPN EG+G I +RDLVKNCLRMRP+R+++GE RG E LD
Sbjct: 393 TVEDAAELRLYQPNLVSLEARPPNQEGKGAIEIRDLVKNCLRMRPDRVVIGECRGGEALD 452

Query: 342 LLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQR 401
           +LQAMNTGHDGS+ T H+N+ R+   R+E M+ M G  LP Q +RE I S++++IVQ  R
Sbjct: 453 MLQAMNTGHDGSLTTAHSNSPRDCISRLEVMVMMSGMDLPIQAIREQIASAVNIIVQQSR 512

Query: 402 LRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
             DGSRRIT+ICE+ GMEG+ +   ++ K++  G  E GK++G + +TG + P F+
Sbjct: 513 FSDGSRRITSICEVTGMEGSTVQLSEIFKFQQTGFSEQGKVMGFYTATG-TIPEFY 567


>gi|89053485|ref|YP_508936.1| type II secretion system protein E [Jannaschia sp. CCS1]
 gi|88863034|gb|ABD53911.1| type II secretion system protein E [Jannaschia sp. CCS1]
          Length = 496

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 289/427 (67%), Gaps = 1/427 (0%)

Query: 38  QSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           + ++P A G       R     E+K+ +   L++ ++++ L        R EI ++ +E 
Sbjct: 57  KPATPEAAGAEDKDRKRRLRLDEIKTEMHHRLLDNLNLSALETAKESELRSEITSITSEQ 116

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           +    + ++ +++  L  +L +++ G GPL+PL+  D + DI+VNG N+VFIE  GK   
Sbjct: 117 LGEMGVVLNREDRQTLNIELFDEVTGLGPLEPLLKDDGVNDILVNGPNRVFIERAGKLQL 176

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           + + F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N ++PP+A+DG  ++IR
Sbjct: 177 SDVRFKDERHLLRIIDKIVSAVGRRVDESNPYVDARLKDGSRFNAMVPPVAVDGSLVSIR 236

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KFKK+KL +D LV FGA + E A  +Q     R NV++SGGTGSGKTT LN L+ +ID  
Sbjct: 237 KFKKEKLGVDDLVKFGAFSEEMAAYIQAAVACRLNVIVSGGTGSGKTTTLNALSSFIDNS 296

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G +T RD ++N LRMRP+RII+GE RG 
Sbjct: 297 ERILTIEDTAELQLQQVHVGRMESRPPNVEGKGAVTQRDCLRNALRMRPDRIIVGETRGE 356

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           EV+D+LQAMNTGHDGSM TIHANNAR++  R+E M+AM G  +P + VR  I+S++ +IV
Sbjct: 357 EVIDMLQAMNTGHDGSMTTIHANNARDACSRLENMVAMAGIEMPLKAVRAQISSAVHLIV 416

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q  RL+DGSRR+ +I E+ GMEG VI  Q++ +++  G    GK++G   + GV R  + 
Sbjct: 417 QASRLQDGSRRMVSITEVTGMEGEVISMQEVFRFQRTGLQPDGKILGHFTACGV-RSYYS 475

Query: 458 NRAAQYG 464
            R  Q+G
Sbjct: 476 ERFRQWG 482


>gi|10334985|gb|AAD38172.2|AF152598_1 TadA [Aggregatibacter actinomycetemcomitans]
 gi|26000715|gb|AAN75211.1| TadA [Aggregatibacter actinomycetemcomitans]
          Length = 426

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/408 (47%), Positives = 282/408 (69%), Gaps = 8/408 (1%)

Query: 73  IDITQLSQYDSQ--SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           +DI ++ +  S+  S  +E+  ++N + +     ++  + L + E + ++I GYGPL+ L
Sbjct: 18  LDIEKIDELQSERSSLVNELVQIVNRVANKSGAYLTSADTLVMAEIVADEIEGYGPLRDL 77

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +A D I DI+VNG N +++E  G   +T   F  NEQL  + +R+V +VGRR+D+ SP+ 
Sbjct: 78  MADDTINDILVNGPNDIWVERAGILEKTDKEFVSNEQLTDIAKRLVARVGRRIDDGSPLV 137

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           D+RL DGSR+NV+I P+ALDG +++IRKF K+K TL  LV+FG++T E A  L I  R R
Sbjct: 138 DSRLPDGSRLNVVIAPIALDGTSISIRKFSKNKKTLQELVNFGSMTREMANFLIIAARSR 197

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +E  G
Sbjct: 198 VNIIVSGGTGSGKTTLLNALSNYISHTERVITLEDTAELRLEQPHVVRLETRLAGVEHTG 257

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
           E+TM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E
Sbjct: 258 EVTMQDLVINALRMRPERIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLE 317

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
           +M+ M   +LP + +R  I+S++++IVQ  RL DGSR+I NI E++GME   I+ QD+  
Sbjct: 318 SMVMMSNASLPLEAIRRNISSAVNIIVQASRLNDGSRKIMNITEVMGMENGQIVLQDMFS 377

Query: 431 YEVMG-EDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           Y+     D+ GK++G+ I+ G ++R   +  A  +    NL+  LQS+
Sbjct: 378 YKASKYRDKEGKILGEFINHGLLTRSIVFQNAQVF----NLSAELQSI 421


>gi|260778159|ref|ZP_05887052.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606172|gb|EEX32457.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
          Length = 445

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/418 (48%), Positives = 288/418 (68%), Gaps = 5/418 (1%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           HY+ + S +    IE   + +LS    Q     I  L+ ++V+  ++ +   E   + + 
Sbjct: 30  HYHLIHSQVVNA-IEASVVIKLS---PQELEARILLLVTDVVATHQLPLGNREVALVVKQ 85

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           L +++LG GPLQPLI    ++DIMVNG N+V+IE  GK  +T + FR  EQLL++ +RIV
Sbjct: 86  LVDELLGLGPLQPLIDDPMVSDIMVNGPNEVYIEKLGKLQKTSVEFRSEEQLLNLARRIV 145

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
           ++VGRR+DESSP+ DARL DGSRVNV+IPPLALDG  ++IRKF ++KL+L+ +   GA++
Sbjct: 146 SKVGRRIDESSPLVDARLEDGSRVNVMIPPLALDGTCISIRKFNQEKLSLNQMAQNGAMS 205

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
               RLL II R R NVLI+GGTG+GKTTLLN ++  I   ERI+T ED AELQLQQPHV
Sbjct: 206 DSMVRLLDIIVRCRLNVLIAGGTGAGKTTLLNAMSFSISPHERIITIEDAAELQLQQPHV 265

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VR ETRP N EG   ++ R+LVKN LRMRP+RIILGEVRG E  +++QAMNTGH+GS+ T
Sbjct: 266 VRAETRPANAEGLAAVSQRELVKNALRMRPDRIILGEVRGDEAFEMMQAMNTGHEGSLST 325

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN++ ++  R+E M+ M   TLP   +R  +  ++DV+VQ +R+RDG RR+  I E++
Sbjct: 326 LHANSSLDALVRIENMLMMAQSTLPLFALRRQVADTIDVVVQVERMRDGKRRVVAITEVI 385

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQ 474
           G+EG   +T DL ++EV GED  G+L+G+++S   S P F ++A  Y  +  L   ++
Sbjct: 386 GLEGEQYVTNDLYRFEVQGEDHQGQLLGKYMSAR-SLPAFASKAQYYQLDSQLRSAME 442


>gi|260914309|ref|ZP_05920778.1| pilus assembly protein CpaF [Pasteurella dagmatis ATCC 43325]
 gi|260631410|gb|EEX49592.1| pilus assembly protein CpaF [Pasteurella dagmatis ATCC 43325]
          Length = 425

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 283/416 (68%), Gaps = 8/416 (1%)

Query: 69  LIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGP 126
           L+  +DI ++ Q  S   +  DE+  L+  I     + ++  + L + E + ++I GYGP
Sbjct: 14  LLSNLDIEKIDQLQSDREKLVDELTQLVYRIAGTNGVYITSADALVMAEMIADEIEGYGP 73

Query: 127 LQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDES 186
           ++ L+  + + DI+VNG + +++E  G   +T   F +NEQL  + +R+V +VGRR+D+ 
Sbjct: 74  IRELMEDETVNDILVNGPDNIWVERAGILEKTNRTFVNNEQLTDIARRLVAKVGRRIDDG 133

Query: 187 SPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQII 246
           SP+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV+FG++T E A  L I 
Sbjct: 134 SPLVDSRLPDGSRLNVVIAPIALDGTSMSIRKFSKSKKSLQELVNFGSMTREMANFLIIA 193

Query: 247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNI 306
            R R N+++SGGTGSGKTTLLN L+ YI   ER+VT EDTAEL+L+QPHVVRLETR   +
Sbjct: 194 ARSRVNIIVSGGTGSGKTTLLNALSNYISHQERVVTLEDTAELRLEQPHVVRLETRLAGV 253

Query: 307 EGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESF 366
           E  GE+TM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++ 
Sbjct: 254 EHTGEVTMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANSPRDAT 313

Query: 367 GRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQ 426
            R+E+M+ M   +LP + +R  I S++++IVQ  RL DGSR+I NI E++GME   I+ Q
Sbjct: 314 ARLESMVMMSNASLPLEAIRRNIASAVNIIVQASRLNDGSRKIMNITELMGMENGQIVLQ 373

Query: 427 DLLKYEVMGE-DETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSLEKQS 480
           D+  Y+   + D  GK++G+ IS G ++R   +  A  +    NL+  LQS+ ++S
Sbjct: 374 DIFTYQPSKDRDANGKIMGEFISHGLLTRSVVYQNAQVF----NLSTELQSIFEES 425


>gi|52425832|ref|YP_088969.1| hypothetical protein MS1777 [Mannheimia succiniciproducens MBEL55E]
 gi|52307884|gb|AAU38384.1| hypothetical protein MS1777 [Mannheimia succiniciproducens MBEL55E]
          Length = 426

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/407 (48%), Positives = 279/407 (68%), Gaps = 6/407 (1%)

Query: 73  IDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           +DI +L +  S+  +  DE+  ++ ++ +     ++  +   + E + ++I GYGPL+ L
Sbjct: 18  LDIEKLDEIQSEYGKLVDELVQIVYQVSNQHGHYLTALDASGMAEIIADEITGYGPLREL 77

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +  D I DI+VNG + V+IE  G   +T   F +NEQL  + +R+V +VGRR+D+ SP+ 
Sbjct: 78  MEDDTINDILVNGPDDVWIERAGILEKTNKQFINNEQLTDIAKRLVARVGRRIDDGSPLV 137

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           D+RL DGSR+NV++PP+ALDG +++IRKF K+K +L  LV+FG++T E A  L I  R R
Sbjct: 138 DSRLPDGSRLNVVVPPIALDGTSISIRKFSKNKKSLQELVNFGSMTLEMANFLIIAARSR 197

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +E  G
Sbjct: 198 VNIIVSGGTGSGKTTLLNALSNYISHTERVITLEDTAELRLEQPHVVRLETRIAGVERTG 257

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
            ITM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E
Sbjct: 258 AITMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLE 317

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
           +M+ M   +LP + +R  I +++++IVQ  RL DGSR+ITNI EI+GME   I+ QD+  
Sbjct: 318 SMVMMANASLPLEAIRRNIAAAVNIIVQASRLNDGSRKITNITEIMGMESGHIVLQDIFT 377

Query: 431 YE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSL 476
           Y+     DE GK+IG+ IS G+       + AQ     NL+  LQS+
Sbjct: 378 YQPSKYRDENGKIIGEFISHGLLSNSVVYQNAQI---FNLSNELQSI 421


>gi|127511578|ref|YP_001092775.1| FHA domain-containing protein [Shewanella loihica PV-4]
 gi|126636873|gb|ABO22516.1| FHA domain containing protein [Shewanella loihica PV-4]
          Length = 569

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/424 (45%), Positives = 285/424 (67%), Gaps = 8/424 (1%)

Query: 60  EVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           E +  + T L++ +D+    +++      R +   L+ +I+   K+   + E   L +++
Sbjct: 150 EWRRKVHTELLKQMDLRRVNVNEMSDTELRAQSEVLLKQIIDNFKLPDDI-EISALTKEV 208

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++ +G GPL+ LIA  D+ +IMVN  +++F E  G    + I F D++ +L   +RIV 
Sbjct: 209 LDETIGLGPLEGLIADPDVTEIMVNSHDQIFYEKAGNLYLSDIAFSDDQAVLGAIERIVT 268

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRR+DESSP+ DARL DGSRVN +IPPLAL GP +TIRKF + +L+ + LV+FG+++ 
Sbjct: 269 PIGRRIDESSPMVDARLKDGSRVNAVIPPLALKGPCITIRKFMQRRLSCNDLVAFGSMSQ 328

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
             A  L+I  + + NV+ISGGTGSGKTTLLN L+ +I  +ERIVT ED AELQL QP++V
Sbjct: 329 AMAEFLEIAVKQKRNVVISGGTGSGKTTLLNVLSNFIPDNERIVTVEDAAELQLYQPNLV 388

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE RPPN EG+G I +RDLVKNCLRMRP+R+++GE RG E LD+LQAMNTGHDGS+ T 
Sbjct: 389 SLEARPPNQEGKGAIEIRDLVKNCLRMRPDRVVIGECRGGEALDMLQAMNTGHDGSLTTA 448

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           H+N+ R+   R+E M+ M G  LP   +RE ITS++++IVQ  R  DGSRR+T+ICE+ G
Sbjct: 449 HSNSPRDCISRLEVMVMMAGMDLPVTAIREQITSAVNIIVQQSRFCDGSRRVTSICEVTG 508

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQSLE 477
           +EG V+   ++ K++  G DE GK+ G + +TG + P F+ +  + G    +A  L   +
Sbjct: 509 IEGTVVQLSEIFKFQQTGFDEQGKVQGYYTATG-TLPEFYEQLRKQG----IAVRLDIFD 563

Query: 478 KQSR 481
           K SR
Sbjct: 564 KDSR 567


>gi|293391329|ref|ZP_06635663.1| pilus assembly protein CpaF [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|32452626|gb|AAP43988.1| TadA [Aggregatibacter actinomycetemcomitans]
 gi|290951863|gb|EFE01982.1| pilus assembly protein CpaF [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 426

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/408 (47%), Positives = 280/408 (68%), Gaps = 8/408 (1%)

Query: 73  IDITQLSQYDSQ--SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           +D+ ++ +  S+  S  +E+  ++N I +     ++  + L + E + ++I GYGPL+ L
Sbjct: 18  LDVEKIDELQSERNSLVNELVQIVNRIANKSNTYLTSADALVMAEIVADEIEGYGPLRDL 77

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +A D I DI+VNG N +++E  G   +T   F  NEQL  + +R+V +VGRR+D+ SP+ 
Sbjct: 78  VADDTINDILVNGPNDIWVERAGILEKTDKEFVSNEQLTDIAKRLVARVGRRIDDGSPLV 137

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV+FG++T + A  L I  R R
Sbjct: 138 DSRLPDGSRLNVVIAPIALDGTSISIRKFSKSKKSLQELVNFGSMTRDMANFLIIAARSR 197

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +E  G
Sbjct: 198 VNIIVSGGTGSGKTTLLNALSNYISHTERVITLEDTAELRLEQPHVVRLETRLAGVEHTG 257

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
           E+TM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E
Sbjct: 258 EVTMQDLVINALRMRPERIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLE 317

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
           +M+ M   +LP + +R  I S++++IVQ  RL DG+R+I NI EI+GME   I+ QD+  
Sbjct: 318 SMVMMSNASLPLEAIRRNIASAVNIIVQASRLNDGTRKIMNITEIMGMENGQIVLQDIFS 377

Query: 431 YEVMG-EDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           Y+     D+ GK+IG+ ++ G ++R   +  A  +    NL+  LQS+
Sbjct: 378 YKASKYRDKDGKIIGEFVNHGLLTRSAVFQNAQVF----NLSTELQSI 421


>gi|309789630|ref|ZP_07684211.1| type II secretion system protein E [Oscillochloris trichoides DG6]
 gi|308228366|gb|EFO82013.1| type II secretion system protein E [Oscillochloris trichoides DG6]
          Length = 473

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/352 (51%), Positives = 252/352 (71%), Gaps = 1/352 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           LFE +C++++G+GP+Q L+  D I+++MVNG N++++E  GK   + + F  +E +L V 
Sbjct: 104 LFEMVCDELMGFGPIQQLLNDDTISEVMVNGPNRIYVEQKGKLRVSPVVFASDEHVLKVI 163

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            RI+  +GRRVD   P+ DARL DGSRVN IIPP A+DG T+TIRKF K+KL +D L+ F
Sbjct: 164 DRIIRPLGRRVDRKWPMVDARLPDGSRVNAIIPPCAIDGCTVTIRKFSKNKLKVDDLIRF 223

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G++T E    L+     R N++++GGTGSGKTTLLN L+ +I +DERIVT ED+AELQL 
Sbjct: 224 GSMTPEMGEFLRACVISRLNIVVAGGTGSGKTTLLNVLSNFIPEDERIVTIEDSAELQLA 283

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HVVRLE +P  ++G G +++RDLV N LRMRPER+++GE RG E LD+LQAMNTGHDG
Sbjct: 284 QDHVVRLEAKPAEVDGTGRVSIRDLVINSLRMRPERVVIGECRGGETLDMLQAMNTGHDG 343

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HAN  R++  RME M  M G  LP +++RE I S++DVIVQ  RL DG R++T I
Sbjct: 344 SLTTLHANTPRDAIARMETMSMMAGMDLPLKVIREQIASAIDVIVQQSRLDDGQRKVTYI 403

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            E+ GMEG  ++ QD+ K +++G+   GK+  +   TGV RPRF  R   +G
Sbjct: 404 TEVQGMEGEKVVLQDIFKLDILGKTPEGKIQAELRPTGV-RPRFTPRLEAHG 454


>gi|239908018|ref|YP_002954759.1| type II/IV secretion system protein family protein [Desulfovibrio
           magneticus RS-1]
 gi|239797884|dbj|BAH76873.1| type II/IV secretion system protein family protein [Desulfovibrio
           magneticus RS-1]
          Length = 457

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 208/434 (47%), Positives = 296/434 (68%), Gaps = 6/434 (1%)

Query: 33  QKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT 92
           Q    Q+ +P     +G     +  YYE+K+ I   LI++ID+T L   +  +   EI+ 
Sbjct: 12  QMPRAQAPAPERREALGPI---SQEYYEIKTRIHDRLIDLIDLTLLDTLEESALGGEISK 68

Query: 93  LMNEIV--SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIE 150
           ++  ++     +  ++  E+  L  ++ +++LG GPL+P +    + DI+VN   ++++E
Sbjct: 69  IVERLLRDEFYQTPLNQAERDRLITEVKDEMLGLGPLEPFLKDQSVNDILVNSYRQIYVE 128

Query: 151 VNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALD 210
             GK V T   F+DN+ L  +  RIV++VGRRVDESSP+ DARL DGSRVN IIPPLA+D
Sbjct: 129 RGGKLVLTESRFKDNDHLKKIIDRIVSRVGRRVDESSPMVDARLPDGSRVNAIIPPLAID 188

Query: 211 GPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCL 270
           GP L+IRKF K+KLT++ L+ F A+T + A +L+ I   R N+LISGGTG+GKTT+LNCL
Sbjct: 189 GPALSIRKFAKEKLTIEDLIRFKAMTRDFADVLKGIVLARLNILISGGTGTGKTTMLNCL 248

Query: 271 TRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERII 330
           + +I  DERIVT ED AELQL+Q HVVRLE+RPPNIEG GE+T RDLV+NCLRMRP+RII
Sbjct: 249 SGFIPHDERIVTVEDAAELQLKQDHVVRLESRPPNIEGRGEVTQRDLVRNCLRMRPDRII 308

Query: 331 LGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIIT 390
           +GEVRG E LD+LQAMNTGHDGS+ T+HAN  R++  R+E ++AM G  + +  ++  I 
Sbjct: 309 VGEVRGAEALDMLQAMNTGHDGSLATLHANTPRDALMRLETLVAMAGLNISALSLKRYIA 368

Query: 391 SSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTG 450
           S++DVIVQ  R  DGSR++ +  E+ GMEG+VI  Q++  +E  G    GK+ G  ++ G
Sbjct: 369 SAVDVIVQISRFSDGSRKLVSFQELTGMEGDVITMQEIFAFEQRGVTADGKVKGVFMARG 428

Query: 451 VSRPRFWNRAAQYG 464
           + RP+F +R    G
Sbjct: 429 I-RPKFASRFEAKG 441


>gi|85859134|ref|YP_461336.1| flp pilus assembly protein, ATPase [Syntrophus aciditrophicus SB]
 gi|85722225|gb|ABC77168.1| flp pilus assembly protein, ATPase [Syntrophus aciditrophicus SB]
          Length = 442

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/407 (48%), Positives = 283/407 (69%), Gaps = 3/407 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKK--ITMSLDEQLDLFEDL 117
           E+K+ +   LIE++D++ +   D    + EI  ++  I++  +  I M+ +E+    +++
Sbjct: 21  ELKAKVHDRLIEILDLSLIETLDPTRLKQEIGRIIERILAEDEFAIPMNAEEKARFCQEV 80

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GP++PL+    + DI+VN  + +++E  GK   T   F+DN  L  +  RIV+
Sbjct: 81  QDEVLGLGPIEPLMQDPTVTDILVNAHDHIYVERFGKLHLTDSRFKDNAHLKKIIDRIVS 140

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRR+DES P+ DARL DGSRVN IIPPLA+DGP L+IR+F  D L +D L++   +T 
Sbjct: 141 NVGRRIDESCPMVDARLADGSRVNAIIPPLAIDGPMLSIRRFSADPLEMDDLITLRTLTP 200

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A L++ I   R NVLISGGTG+GKTT+LN L+R+I  +ERIVT ED+AELQL+Q HVV
Sbjct: 201 EIAELIKGIVASRLNVLISGGTGTGKTTMLNVLSRFIPSNERIVTIEDSAELQLKQEHVV 260

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG+GE+T RDLV+N LRMRP+RII+GEVR  EVLD+LQAMNTGHDGS+ TI
Sbjct: 261 RLETRPENIEGKGEVTQRDLVRNSLRMRPDRIIVGEVRSAEVLDMLQAMNTGHDGSLTTI 320

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++  RME ++AM G  +P+  +R  ++S+LDVI+Q  RL DGSR++ ++ EI G
Sbjct: 321 HANTPRDALLRMETLVAMSGLNIPNDAIRRYVSSALDVIIQVARLVDGSRKLVSLQEITG 380

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           MEGNVI  Q++  ++  G D  G++ G+   + +  P+F  R    G
Sbjct: 381 MEGNVITMQEIFSFKQTGVDAKGQVKGRFEVSPIL-PKFLERFKSMG 426


>gi|303248306|ref|ZP_07334568.1| type II secretion system protein E [Desulfovibrio fructosovorans
           JJ]
 gi|302490331|gb|EFL50243.1| type II secretion system protein E [Desulfovibrio fructosovorans
           JJ]
          Length = 456

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 204/410 (49%), Positives = 286/410 (69%), Gaps = 3/410 (0%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLF 114
            YYE+K+ I   LI++ID++ L   D+ +   EI  L+  ++     +  ++  E+  + 
Sbjct: 32  EYYEIKTRIHDRLIDLIDLSLLDTLDAGAIGAEIGKLVERLLRDEFAQTPLNQAERERMI 91

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
            ++ +++LG GPL+P +    + DI+VN   ++++E  GK V T   F+DN+ L  +  R
Sbjct: 92  SEVKDEMLGLGPLEPFLKDPSVNDILVNSYRQIYVERAGKLVLTESRFKDNDHLKKIIDR 151

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV++VGRRVDESSP+ DARL DGSRVN IIPPLA+DGP L+IRKF K+KLT++ L+ F A
Sbjct: 152 IVSRVGRRVDESSPMVDARLPDGSRVNAIIPPLAIDGPALSIRKFAKEKLTIEDLIRFRA 211

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T + A +LQ I   R N+LISGGTG+GKTT+LNCL+ +I  DERIVT ED AELQL+Q 
Sbjct: 212 MTRDFAEVLQGIVLARLNILISGGTGTGKTTMLNCLSGFIPHDERIVTVEDAAELQLKQD 271

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLE+RPPNIEG GE+T RDLV+NCLRMRP+RII+GEVRG E LD+LQAMNTGHDGS+
Sbjct: 272 HVVRLESRPPNIEGRGEVTQRDLVRNCLRMRPDRIIVGEVRGAEALDMLQAMNTGHDGSL 331

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T+HAN  R++  R+E ++AM G T+    ++  I S++DVI+Q  R  DGSR++ +  E
Sbjct: 332 ATLHANTPRDALMRLETLVAMAGLTISPLSLKRYIASAVDVIIQISRFSDGSRKLVSFQE 391

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + GMEG VI  Q++  +E  G    GK+ G  ++ G+ RP+F  +    G
Sbjct: 392 LTGMEGEVITMQEIFAFEQRGVSADGKVKGAFLARGI-RPKFAAKFESKG 440


>gi|326797330|ref|YP_004315150.1| type II secretion system protein E [Marinomonas mediterranea MMB-1]
 gi|326548094|gb|ADZ93314.1| type II secretion system protein E [Marinomonas mediterranea MMB-1]
          Length = 455

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/408 (45%), Positives = 279/408 (68%), Gaps = 1/408 (0%)

Query: 59  YEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLC 118
           Y+ K  I   L E ID  + +    +    +I +++  I    ++ +SLD++  +  ++ 
Sbjct: 47  YKNKRLIRQKLYEQIDPIKAATLSHEQLNQQIESIIRGICDHNRLQLSLDDEQTICREMF 106

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           ++++G GP++PL+A D + DI+VNG+ +VFIE  GK   + I F D E +L++ QRI   
Sbjct: 107 HEMIGIGPIEPLLADDSVNDILVNGAGQVFIERYGKLELSTIRFIDEEHVLNIAQRIAAA 166

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+ P+ DARL DGSRVN+I  PLA+DG +++IRKF +  ++L+ L S  A++  
Sbjct: 167 VGRRIDETQPMVDARLADGSRVNIITHPLAIDGTSISIRKFMRRNMSLEVLESGNALSTG 226

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
              +L+   + + N+++SGGTG+GKTTLLN L++ I  D+RI+T ED AELQLQQ HVVR
Sbjct: 227 MVTVLRRAMQGKLNIIVSGGTGAGKTTLLNALSQEISGDDRIITIEDAAELQLQQIHVVR 286

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP + EG G++  RDLV+N LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+H
Sbjct: 287 LETRPVSAEGTGKVDQRDLVRNALRMRPDRIILGEVRGGESFDMLQAMNTGHDGSLCTVH 346

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M+ M G  LP + +R  I S++D++VQ +R+RDGSRRI ++ E+ GM
Sbjct: 347 ANTPRDAIMRLENMVMMAGMQLPQEAIRRQIASAVDLVVQVERMRDGSRRIVSVTEVCGM 406

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           E +VI TQ++  +     D  GK++G+ +S+G  RP F+   + Y ++
Sbjct: 407 EDDVIQTQEIFGFRTDSVDSLGKIVGEFVSSG-QRPAFYATHSHYFQD 453


>gi|307548790|dbj|BAJ19112.1| TadA [Aggregatibacter actinomycetemcomitans]
 gi|307548805|dbj|BAJ19126.1| TadA [Aggregatibacter actinomycetemcomitans]
          Length = 426

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/408 (47%), Positives = 281/408 (68%), Gaps = 8/408 (1%)

Query: 73  IDITQLSQYDSQ--SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           +DI ++ +  S+  S  +E+  ++N + +     ++  + L + E + ++I GYGPL+ L
Sbjct: 18  LDIEKIDELQSERSSLVNELVQIVNRVANKSGAYLTSADTLVMAEIVADEIEGYGPLRDL 77

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +A D I DI+VNG N +++E  G   +T   F  NEQL  + +R+V +VGRR+D+ SP+ 
Sbjct: 78  MADDTINDILVNGPNDIWVERAGILEKTDKEFVSNEQLTDIAKRLVARVGRRIDDGSPLV 137

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           D+RL DGSR+NV+I P+ALDG +++IRKF K+K TL  LV+FG++T E A  L I  R R
Sbjct: 138 DSRLPDGSRLNVVIAPIALDGTSISIRKFSKNKKTLQELVNFGSMTREMANFLIIAARSR 197

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLET    +E  G
Sbjct: 198 VNIIVSGGTGSGKTTLLNALSNYISHTERVITLEDTAELRLEQPHVVRLETHLAGVEHTG 257

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
           E+TM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++  R+E
Sbjct: 258 EVTMQDLVINALRMRPERIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLE 317

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
           +M+ M   +LP + +R  I+S++++IVQ  RL DGSR+I NI E++GME   I+ QD+  
Sbjct: 318 SMVMMSNASLPLEAIRRNISSAVNIIVQASRLNDGSRKIMNITEVMGMENGQIVLQDIFS 377

Query: 431 YEVMG-EDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           Y+     D+ GK++G+ I+ G ++R   +  A  +    NL+  LQS+
Sbjct: 378 YKASKYRDKEGKILGEFINHGLLTRSVVFQNAQVF----NLSAELQSI 421


>gi|147677786|ref|YP_001212001.1| type IV secretory pathway, VirB11 components, and related ATPase
           [Pelotomaculum thermopropionicum SI]
 gi|146273883|dbj|BAF59632.1| type IV secretory pathway, VirB11 components, and related ATPase
           [Pelotomaculum thermopropionicum SI]
          Length = 450

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/437 (45%), Positives = 303/437 (69%), Gaps = 6/437 (1%)

Query: 30  SNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSAR-- 87
           + ++KQ    +  + + +   F  + P Y ++K+ I   +I+  ++  +   +  SAR  
Sbjct: 5   ARLEKQKTLKTDKNEQLKPQAFTKKDP-YEQLKTAIHKKIID--ELKDMPPDEESSARLA 61

Query: 88  DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           ++I  ++ + +  +   +S  ++L + +++ +D + +GP+ PL+   DI ++MVNG +KV
Sbjct: 62  EKIEKMVLDFLDNEGEQISRPDRLRIAKEIVDDAIAFGPITPLLNDPDITEVMVNGPDKV 121

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           +IE NG    T I FR+N  ++ V ++IV  +GRR+DES P+ DARL DGSRVN IIPPL
Sbjct: 122 YIEKNGIIQLTDIRFRNNSHVMHVIEKIVAPLGRRIDESMPMVDARLPDGSRVNAIIPPL 181

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           AL+GPT+TIRKF KD LT+D L+  G +T + A  L+   + R N+++SGGTGSGKTT L
Sbjct: 182 ALNGPTVTIRKFFKDPLTIDDLIRLGTLTPQIAIFLESCVKARLNIVVSGGTGSGKTTTL 241

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           N L+ +I ++ERI+T ED AELQL+Q HV+ LE+RPPNIEG+G IT+RDLV+N LRMRP+
Sbjct: 242 NILSSFIPENERIITIEDAAELQLRQEHVITLESRPPNIEGKGAITIRDLVRNALRMRPD 301

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RI++GEVR  E LD+LQAMNTGHDGS+ T HAN+ R+   R+E M+ M G  LP + +RE
Sbjct: 302 RIVVGEVRSGEALDMLQAMNTGHDGSLTTGHANSPRDMLSRLETMVLMAGMELPVKAIRE 361

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHI 447
            I+S++D+I+   RLRDGSR+IT+I E+ GMEG++I+ QD+  Y+  G D  G++ G+ I
Sbjct: 362 QISSAIDLIIHQSRLRDGSRKITHITEVQGMEGDIIVLQDIYLYKQEGIDADGRIRGRFI 421

Query: 448 STGVSRPRFWNRAAQYG 464
           +TG+ RP+F  +   +G
Sbjct: 422 ATGI-RPKFLGQLEAHG 437


>gi|322434106|ref|YP_004216318.1| type II secretion system protein E [Acidobacterium sp. MP5ACTX9]
 gi|321161833|gb|ADW67538.1| type II secretion system protein E [Acidobacterium sp. MP5ACTX9]
          Length = 452

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 287/436 (65%), Gaps = 7/436 (1%)

Query: 43  SAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQ-SARDEIATLMNEIVSVK 101
           +A G +G   +      ++K+ +   LI+ +D+ +L+   S  + + ++   ++++V  +
Sbjct: 22  TASGALGEAASN-----QLKTAVHHELIKRMDLEKLAGMSSDPNGKQKLLVTISQLVGEQ 76

Query: 102 KITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGIN 161
            I ++  ++  + +++ +++ G GPL+PL+    ++DI+VN  + V++E  G   +T + 
Sbjct: 77  NIPLTGSDRERIAKEVMDEVFGLGPLEPLLHDSTVSDILVNTYDTVYVERRGVIEKTDVV 136

Query: 162 FRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKK 221
           FRDN  L+ +  +IV+ VGRR+DESSP+ DARLLDGSRVN++IPPLA+DGP ++IRKF  
Sbjct: 137 FRDNAHLMHIIDKIVSAVGRRIDESSPMVDARLLDGSRVNIVIPPLAVDGPLISIRKFGS 196

Query: 222 DKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIV 281
             LT D L+   A+T     +L+   + R N+++SGGTGSGKTTLLN L+ YI  DERI+
Sbjct: 197 TPLTADDLLRNRALTPHMLEILKGAVKARLNIVVSGGTGSGKTTLLNVLSGYISPDERIL 256

Query: 282 TCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLD 341
           T ED+AELQ++Q HV RLE RPPN+EG+G I  R+LV N LRMRP+RIILGE+RG E LD
Sbjct: 257 TIEDSAELQIKQQHVARLECRPPNVEGKGAIKQRELVINALRMRPDRIILGEIRGEEALD 316

Query: 342 LLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQR 401
           +LQAMNTGHDGS+ TIHANN R++  R+E M  MG   LP + +R  I S++ +IVQ  R
Sbjct: 317 MLQAMNTGHDGSITTIHANNPRDAIARLETMAMMGSVALPEKAIRAQIASAVHLIVQASR 376

Query: 402 LRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAA 461
           + DGSRRIT+I EI G    V+  QD+  +E  G     K+ G+  +TG+  P+F  +  
Sbjct: 377 MSDGSRRITHISEITGATTEVVSMQDIFLFEKQGLGAANKVKGRFYATGIV-PKFAEKLK 435

Query: 462 QYGEEKNLAEVLQSLE 477
             G    L  + QS+E
Sbjct: 436 AAGIPLGLNMMDQSVE 451


>gi|225174958|ref|ZP_03728955.1| type II secretion system protein E [Dethiobacter alkaliphilus AHT
           1]
 gi|225169598|gb|EEG78395.1| type II secretion system protein E [Dethiobacter alkaliphilus AHT
           1]
          Length = 460

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/415 (46%), Positives = 285/415 (68%), Gaps = 3/415 (0%)

Query: 71  EMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPL 130
           E + + +   ++ ++  ++I+  +  ++  +    SL ++  +   + ++I GYGP+ PL
Sbjct: 47  ETMTMEKRGAFERKAVEEQISHTLEGVLETRDRHFSLADKQRVVRKIIDEIFGYGPINPL 106

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           I    + ++MVNG   V++E +GK + T   FRD+  ++ +  +I+  +GRR+DESSP+ 
Sbjct: 107 INDPTVTEVMVNGPRHVYVERDGKLIHTDTVFRDDAHVMHIIDKIITPLGRRIDESSPMV 166

Query: 191 DARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIR 250
           DARL DGSRVN IIPPL++ GPT+TIRKF  D  T+D L++FG +++E A+ L+   + R
Sbjct: 167 DARLPDGSRVNAIIPPLSVKGPTITIRKFSADPFTMDDLITFGTMSSEVAKFLRSCVKSR 226

Query: 251 CNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEG 310
            N++++GGTGSGKTT+LN L+ +I   +RIVT ED AELQLQQ HV+ LE+RP NIEG+G
Sbjct: 227 VNIIVTGGTGSGKTTVLNVLSGFIPTTDRIVTIEDAAELQLQQNHVITLESRPANIEGKG 286

Query: 311 EITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRME 370
           ++++RDLV N LRMRP+RI++GEVRG E LD+LQAMNTGHDGS+ T+HANN R+   R+E
Sbjct: 287 KVSIRDLVINSLRMRPDRIVVGEVRGGEALDMLQAMNTGHDGSITTLHANNPRDGLARLE 346

Query: 371 AMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLK 430
            M+ M G  LP + +RE I+S++++IV + R  DGSR+IT + E+VGMEG+ I  QDL  
Sbjct: 347 TMVLMAGMDLPLRAIREQISSAINLIVHSVRFSDGSRKITKVTEVVGMEGDTITLQDLFV 406

Query: 431 YEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGE--EKNLAEVLQSLEKQSRAL 483
           +E  G  E G++IG H+ TG+  P F ++   YGE   KN+    Q  E  +R L
Sbjct: 407 FEHKGFSERGEVIGSHMPTGII-PSFLDKLHAYGERISKNMFRNGQQSEFSNRRL 460


>gi|84501673|ref|ZP_00999845.1| type II/IV secretion system protein, TadA subfamily protein
           [Oceanicola batsensis HTCC2597]
 gi|84390294|gb|EAQ02853.1| type II/IV secretion system protein, TadA subfamily protein
           [Oceanicola batsensis HTCC2597]
          Length = 444

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 275/381 (72%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI ++  E++  K I ++ +E+  L ++L +++ G GPL+ L+  + ++DI+VNG
Sbjct: 51  QELRMEINSIATEVLQEKGIVLNREERTTLNQELYDEVKGLGPLESLLKDETVSDILVNG 110

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
            +++FIE NGK   + I F+D + LL +  +IV+ VGRRVDE +P  DARL DGSR N +
Sbjct: 111 PHQIFIERNGKLQLSDITFKDEKHLLRIIDKIVSAVGRRVDEMNPYVDARLQDGSRFNAM 170

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           +PP+A+DG  ++IRKFKKDKL +D LV+FGA T E A  LQ     R NV++SGGTGSGK
Sbjct: 171 VPPIAVDGSLVSIRKFKKDKLGIDELVNFGAFTEEMAAYLQAAVATRLNVIVSGGTGSGK 230

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RPPN+EG+G ++ RD +KN LR
Sbjct: 231 TTTLNALSSFIDDSERILTIEDTAELQLQQTHVGRMESRPPNVEGKGAVSPRDCLKNALR 290

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+AR+   R+E MI+M G  +P +
Sbjct: 291 MRPDRIIVGETRGDEVIDMLQAMNTGHDGSMTTIHANSARDGVARLENMISMSGIDMPLK 350

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            +R  I+S++ +IVQ  RL+DG+RR+T+I EI GMEG+VI  Q++ +++  G     K++
Sbjct: 351 AMRSQISSAVHLIVQASRLQDGTRRMTSITEITGMEGDVISMQEVFRFQRTGLTPENKIV 410

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G   +TGV R  F +R   +G
Sbjct: 411 GHFTATGV-RSNFADRFKMWG 430


>gi|116671471|ref|YP_832404.1| type II secretion system protein E [Arthrobacter sp. FB24]
 gi|116611580|gb|ABK04304.1| type II secretion system protein E [Arthrobacter sp. FB24]
          Length = 471

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 276/380 (72%), Gaps = 6/380 (1%)

Query: 86  ARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSN 145
           ARDE++ +++E    +++ +S +E+  L  D+ +D+LGYGPLQ  +    + +IMVN  +
Sbjct: 79  ARDELSLVIDE----EQVPLSPEERRRLIRDVGDDVLGYGPLQRYLEDPSVTEIMVNRPD 134

Query: 146 KVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIP 205
           +V++E +G+ + T   F   E L  V +RIV +VGRR+DESSP+ DARL DGSRVN IIP
Sbjct: 135 QVYVERDGRLILTDGRFSSEEHLRKVIERIVAKVGRRIDESSPLVDARLEDGSRVNAIIP 194

Query: 206 PLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTT 265
           PLA++G +LTIRKF K  LT+ +L+ FG +T E A LL    R + N+++SGGTG+GKTT
Sbjct: 195 PLAVNGSSLTIRKFSKIPLTVQNLIDFGTLTPEMAELLDACVRAKLNIIVSGGTGTGKTT 254

Query: 266 LLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMR 325
           LLN L+ +I  D+RIVT ED  ELQLQQ HVVRLE+RP NIEG+G +T+RDLV+N LRMR
Sbjct: 255 LLNVLSSFIPSDDRIVTIEDAVELQLQQSHVVRLESRPANIEGKGAVTIRDLVRNSLRMR 314

Query: 326 PERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMV 385
           P+RI++GEVRG E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E ++ M G  LP + +
Sbjct: 315 PDRIVVGEVRGGESLDMLQAMNTGHDGSISTVHANSPRDAVARLETLVLMAGMDLPLRAI 374

Query: 386 REIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE-VMGEDETGKLIG 444
           RE ++S++++IV   RLRDG+RR+T+I E+ GMEG ++  QD   ++   G D  G+ +G
Sbjct: 375 REQVSSAVNLIVHLSRLRDGTRRVTHITEVQGMEGEIVTLQDAFVFDYAAGVDANGRFLG 434

Query: 445 QHISTGVSRPRFWNRAAQYG 464
           + ISTG+ RPRF +  A  G
Sbjct: 435 KPISTGI-RPRFVDHFADLG 453


>gi|253996763|ref|YP_003048827.1| type II secretion system protein E [Methylotenera mobilis JLW8]
 gi|253983442|gb|ACT48300.1| type II secretion system protein E [Methylotenera mobilis JLW8]
          Length = 452

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/428 (46%), Positives = 291/428 (67%), Gaps = 6/428 (1%)

Query: 37  LQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNE 96
           L+      +G +GN +     Y E++S I   L++ +D++ +     +    E+ TL+  
Sbjct: 16  LEPQGNQTDGLMGNKM-----YQELRSRIHRKLLDRVDLSMMENMPPELLTAELKTLVER 70

Query: 97  IVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTV 156
           +++ + + ++  E+++L  D+ +++LG GPL+ L+    I+DI+VN  N+++IE  GK  
Sbjct: 71  LLTEEAVAINDIERMNLVRDIQHEVLGLGPLEILMVDPTISDILVNTYNQIYIERKGKLE 130

Query: 157 ETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTI 216
            + + F     LL +  +IV+ VGRRVDESSP+ DARL DGSRVN +IPPLA+DG  L+I
Sbjct: 131 LSDVRFESEAHLLKIIDKIVSGVGRRVDESSPMVDARLPDGSRVNAVIPPLAVDGAILSI 190

Query: 217 RKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK 276
           R+F    L ++ L+   ++T E A +L+ + + + N+LISGGTG+GKTTLLN L+ YI +
Sbjct: 191 RRFAITPLMMNDLLRNRSLTPEMAEVLEGLVKAKVNILISGGTGTGKTTLLNVLSGYIPE 250

Query: 277 DERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRG 336
            ERI+T ED AELQLQQPHVVRLE RPPNIEG+GE+T R LV+N LRMRP+RII+GEVRG
Sbjct: 251 TERIITIEDAAELQLQQPHVVRLEIRPPNIEGKGEVTPRMLVRNSLRMRPDRIIVGEVRG 310

Query: 337 PEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVI 396
           PEV+D+LQAMNTGH+GSM T+HAN  R++  R+E M+ M GF LP++ +RE I+S+L  +
Sbjct: 311 PEVVDMLQAMNTGHEGSMATVHANTPRDALTRLENMMGMAGFNLPTKAMREQISSALTAV 370

Query: 397 VQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRF 456
           +   RL DG R++T++ EI GME  VI  QD+  YE  G  E G + G   +TG+ RP+F
Sbjct: 371 IHITRLSDGQRKVTSVKEITGMESEVITMQDIFVYEQTGVSEKGVVQGHFKATGI-RPKF 429

Query: 457 WNRAAQYG 464
             R   +G
Sbjct: 430 IERLRVHG 437


>gi|89068021|ref|ZP_01155438.1| type II/IV secretion system protein, TadA subfamily protein
           [Oceanicola granulosus HTCC2516]
 gi|89046260|gb|EAR52317.1| type II/IV secretion system protein, TadA subfamily protein
           [Oceanicola granulosus HTCC2516]
          Length = 486

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/381 (50%), Positives = 269/381 (70%), Gaps = 1/381 (0%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           Q  R EI+ +  E +    + ++ +E+  L +DL  ++ G GPL+PL+  DD+ DI++NG
Sbjct: 94  QELRTEISAIATETLEDMGVVLNREERQTLNQDLYFEVTGLGPLEPLLKDDDVNDILING 153

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
            +++F+E  GK   + I F+D   LL +  +IV+ VGRRVDES+P  DARL DGSR N +
Sbjct: 154 PHQIFVERAGKLTLSDITFKDERHLLRIIDKIVSAVGRRVDESNPYVDARLADGSRFNAM 213

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           + P+A+DG  ++IRKFKKDKL +D LV+FGA + E A  L+     R NV++SGGTGSGK
Sbjct: 214 VSPIAVDGSLVSIRKFKKDKLGIDELVNFGAFSEEMAAYLEAAVATRLNVIVSGGTGSGK 273

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TT LN L+ +ID  ERI+T EDTAELQLQQ HV R+E+RP N+EG+G +T RD ++N LR
Sbjct: 274 TTTLNALSSFIDNSERILTIEDTAELQLQQTHVGRMESRPANVEGKGAVTQRDCLRNALR 333

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RII+GE RG EV+D+LQAMNTGHDGSM TIHAN+ R++  R+E M+AM G  +P +
Sbjct: 334 MRPDRIIVGETRGEEVIDMLQAMNTGHDGSMTTIHANSGRDAISRLENMVAMAGIEMPIK 393

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            VR  I S++++IVQ  RL+DGSRR+ +I E+ GMEG+VI  Q++ +Y+ +G     K+I
Sbjct: 394 AVRSQIASAVNLIVQASRLQDGSRRMVSITEVTGMEGDVISMQEIFRYQRVGLTPENKII 453

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G   +TGV R  F  R   +G
Sbjct: 454 GHFTATGV-RSHFSERFKLWG 473


>gi|170725112|ref|YP_001759138.1| FHA domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169810459|gb|ACA85043.1| FHA domain containing protein [Shewanella woodyi ATCC 51908]
          Length = 572

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/408 (46%), Positives = 279/408 (68%), Gaps = 6/408 (1%)

Query: 60  EVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD-LFED 116
           E +  + + L++++D+    +++      R +  +L+N+I++   I +  D +++ L ++
Sbjct: 153 EWRRKVHSELLKLMDLRRVNVNEMSDVELRAQSESLINQIIT--SINLPKDIEVESLTKE 210

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ++ +G GPL+ LI   D+ +IMVN  +++F E  G    + I F D++ +L   +RIV
Sbjct: 211 VLDETIGLGPLEGLIDDPDVTEIMVNSHDQIFYEKAGNLYLSDIAFSDDQAVLGAIERIV 270

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
             +GRR+DESSP+ DARL DGSRVN +IPPLAL GP +TIRKF + +L+ D LV FG++ 
Sbjct: 271 TPIGRRIDESSPMVDARLKDGSRVNAVIPPLALKGPCITIRKFMQQRLSCDDLVKFGSMN 330

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
              A  L+     + N++ISGGTGSGKTTLLN L+ +I  +ERIVT ED AELQL QP++
Sbjct: 331 QAMAGFLETAVNQKKNIIISGGTGSGKTTLLNVLSNFIPDNERIVTVEDAAELQLYQPNL 390

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           V LE RPPN EG+G I +RDLVKNCLRMRP+R+++GE RG E LD+LQAMNTGHDGS+ T
Sbjct: 391 VSLEARPPNQEGKGAIEIRDLVKNCLRMRPDRVVIGECRGGEALDMLQAMNTGHDGSLTT 450

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
            H+N+ R+   R+E M+ M G  LP   +RE ITS++++IVQ  R  DGSRRIT+ICEI 
Sbjct: 451 AHSNSPRDCISRLEVMVMMAGMDLPVSAIREQITSAVNIIVQQSRFSDGSRRITSICEIT 510

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G+EG+++   ++ K+E  G +  GK+ G + +TG + P F+ +  + G
Sbjct: 511 GLEGSIVQLSEIFKFEQTGFNSEGKVQGYYTATG-TMPEFYEQLRKQG 557


>gi|312139257|ref|YP_004006593.1| type iv secretion system atpase subunit [Rhodococcus equi 103S]
 gi|311888596|emb|CBH47908.1| type IV secretion system ATPase subunit [Rhodococcus equi 103S]
          Length = 465

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/379 (51%), Positives = 268/379 (70%), Gaps = 6/379 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R+E+A    EIV  +   ++ DE+  L  ++ +++LG+GPLQ L+    + +IMVN  + 
Sbjct: 74  REELA----EIVEQETTPLTFDERQRLLREVADEVLGHGPLQRLLEDPSVTEIMVNSHDM 129

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           V++E +G  V +   F D   L  V +RIV+ VGRR+DESSP+ DARL DGSRVN +IPP
Sbjct: 130 VYVERDGTLVRSSARFADEAHLRRVIERIVSAVGRRIDESSPLVDARLADGSRVNAVIPP 189

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           LA +G +LTIRKF KD   +D L++FG ++ E A LL    + R NV++SGGTG+GKTTL
Sbjct: 190 LAFNGSSLTIRKFSKDPFQVDDLIAFGTLSHEMAELLDACVQARLNVIVSGGTGTGKTTL 249

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I + ERIVT ED  ELQLQQ HVVRLE+RPPNIEG+G +T+RDLV+N LRMRP
Sbjct: 250 LNVLSSFIPEGERIVTIEDAVELQLQQDHVVRLESRPPNIEGKGAVTIRDLVRNSLRMRP 309

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RI++GE RG E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E ++ M G  LP + +R
Sbjct: 310 DRIVVGECRGGESLDMLQAMNTGHDGSLSTVHANSPRDAIARLETLVLMAGMDLPLRAIR 369

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQ 445
           E I S++DVIVQ  RLRDG+RR+T++ E+ GMEG ++  QD   ++   G D  G+ +G+
Sbjct: 370 EQIASAVDVIVQLTRLRDGTRRVTHVTEVQGMEGEIVTLQDAFLFDYSAGVDARGRFLGR 429

Query: 446 HISTGVSRPRFWNRAAQYG 464
              TGV RPRF +R    G
Sbjct: 430 PQPTGV-RPRFTDRFRDLG 447


>gi|284048520|ref|YP_003398859.1| type II secretion system protein E [Acidaminococcus fermentans DSM
           20731]
 gi|283952741|gb|ADB47544.1| type II secretion system protein E [Acidaminococcus fermentans DSM
           20731]
          Length = 466

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/418 (47%), Positives = 286/418 (68%), Gaps = 6/418 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQS-ARDEIATLMN----EIVSVKKITMSLD 108
           R   Y  +K T+   +++ +   Q    DS + +R EI  +++     ++      +   
Sbjct: 32  REEEYQNLKVTVHRAIVDEMSAEQQRVLDSATHSRQEIENVISGYVQRVLEHNPFVVPRG 91

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           E+  L  D+C++ILG GP++P +  D I ++MVNG  K+++E  GK   TG  F DN  L
Sbjct: 92  ERARLVSDICDEILGLGPIEPFLKDDSITEVMVNGPKKIYVERMGKLHLTGAQFHDNNHL 151

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           +++  +IV  +GR VDE+SP+ DARL DGSRVNV+IPPL+L GP +TIRKF +  L++++
Sbjct: 152 MAIIDKIVTPIGRHVDEASPLVDARLQDGSRVNVVIPPLSLIGPCVTIRKFSRTPLSVEN 211

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+SFG ++ E A  L+     + NV+ISGGTGSGKTT LN L+ +I  DERIVT ED AE
Sbjct: 212 LISFGTLSEEMAIFLRACVNAKLNVMISGGTGSGKTTTLNVLSSFIPHDERIVTIEDAAE 271

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           L+L+QPHVV LE RP NIEG+G +T+RDLVKN LRMRP+RII+GEVRG E LD+LQAMNT
Sbjct: 272 LRLEQPHVVTLEARPANIEGKGAVTIRDLVKNSLRMRPDRIIVGEVRGGEALDMLQAMNT 331

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GS+ T HAN+ R+   R+E M+ M G  LP + +R+ I+S+LD+I+  +R++DGSR+
Sbjct: 332 GHEGSLTTAHANSPRDVLSRLETMVLMSGLDLPVRAIRDQISSALDLIIHQERIQDGSRK 391

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           IT I E+  MEG+VI+ QDL +Y   G DE+GK +G+   TG+ +P+F ++   +  E
Sbjct: 392 ITYITEVQKMEGDVIVLQDLFRYVQTGFDESGKALGEFRPTGL-QPQFLSKFKSHNVE 448


>gi|116623253|ref|YP_825409.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226415|gb|ABJ85124.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 454

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/436 (44%), Positives = 282/436 (64%), Gaps = 11/436 (2%)

Query: 30  SNIQKQNLQ-SSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARD 88
           SN +++ LQ ++SP+A           P Y E+K T+   L+E I++  LS  D      
Sbjct: 12  SNWEQRLLQNAASPAAV---------KPEYQELKFTLHRKLLERINLEALSGIDDDRIHA 62

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           E+   +  +V  +   ++  E+  +  ++ +++ G GPL+PL+    I+DI+VNG  +V+
Sbjct: 63  EVRQAVLSMVEEEPNLLTAAEKQRISHEVLHEVFGLGPLEPLLQDATISDILVNGHKQVY 122

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E  G    T + F D   LL +  +IV+QVGRRVDES+P+ DARL DGSRVN IIPPLA
Sbjct: 123 VERKGLLELTSVRFHDEGHLLRIIDKIVSQVGRRVDESNPMVDARLSDGSRVNAIIPPLA 182

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           +DG  L+IR+F  DKL  + LV+ GA+T     LL+   + + N+++SGGTG+GKTTLLN
Sbjct: 183 VDGALLSIRRFGTDKLLPEDLVAKGAMTRGMMLLLEAAVKAKLNIIVSGGTGAGKTTLLN 242

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L+ +I   ERI+T ED AELQL+QPHVVRLETRP N+EG G +  R L+ N LRMRP+R
Sbjct: 243 ALSFFISPKERILTIEDAAELQLKQPHVVRLETRPDNLEGHGAVRQRQLLINSLRMRPDR 302

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           II+GEVRG E LD+LQAMNTGHDGS+ T+HAN  R++  R+E M+ +    +    +R+ 
Sbjct: 303 IIVGEVRGEEALDMLQAMNTGHDGSLTTVHANTPRDAVSRLEVMVTLANANMHLAAIRQQ 362

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIS 448
           ITS++ ++VQ  RL DGSRR+T+I E+ GMEG ++  QD+  +E  G    G ++G   +
Sbjct: 363 ITSAVQILVQCSRLSDGSRRVTSITEVTGMEGEIVTLQDIFVFEKRGLARDGSVLGSFCA 422

Query: 449 TGVSRPRFWNRAAQYG 464
           TG+  P+F  +    G
Sbjct: 423 TGIM-PKFNEKLVASG 437


>gi|119717340|ref|YP_924305.1| type II secretion system protein E [Nocardioides sp. JS614]
 gi|119538001|gb|ABL82618.1| type II secretion system protein E [Nocardioides sp. JS614]
          Length = 491

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/408 (45%), Positives = 276/408 (67%), Gaps = 9/408 (2%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDE----IATLMNEIVSVKKITMSLDEQLDLFE 115
           EVK ++   L++ +   QL  YD++  +DE    +  ++ E++  +   +S  ++  + +
Sbjct: 73  EVKGSVHAELLQQLG-PQL--YDAEMDQDELDQRVRAVLAEVLGAEDRPLSHSDRARVTQ 129

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           ++ +DILGYGP++P +    ++++MVNG++ ++IE  G+   T  +F D   L  V  +I
Sbjct: 130 EISDDILGYGPIEPFLREPTVSEVMVNGAHSIWIERAGRIEPTAAHFVDESHLRRVIDKI 189

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+++GRRVDESSP+ DARL DGSRVN +IPPLA+DG  LTIRKF    LT + LV+FG +
Sbjct: 190 VSRIGRRVDESSPMVDARLPDGSRVNAVIPPLAIDGSALTIRKFATTPLTAEDLVTFGTL 249

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           +      L    R R NV++SG TG+GKTT LN L+ +I  DERIVT ED AELQL+Q H
Sbjct: 250 SEPARDFLAACVRGRLNVIVSGSTGAGKTTTLNVLSSFIPSDERIVTIEDAAELQLEQEH 309

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE+RPPNIEG G +  RDLV+N LRMRP+RI++GEVR    LD+LQAMNTGHDGS+ 
Sbjct: 310 VVRLESRPPNIEGRGGVDTRDLVRNALRMRPDRIVVGEVRDASALDMLQAMNTGHDGSIC 369

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+H+N  R++  R+E M+ M G  LP + +RE + S++D+IV   R +DGSRR+T+I E+
Sbjct: 370 TVHSNGPRDTLARIETMVLMAGMDLPVRAIREQMASAVDLIVHQTRFKDGSRRVTHITEV 429

Query: 416 VGMEGNVIITQDLLKY-EVMGEDETGKLIGQHISTGVSRPRFWNRAAQ 462
             MEG+V+  QD+  + +  G D  G+ +GQ +++G+ RP+   + A 
Sbjct: 430 ERMEGDVVTLQDVFVFDQSPGFDAEGRSLGQLVASGL-RPKLLEKLAH 476


>gi|269836551|ref|YP_003318779.1| type II secretion system protein E [Sphaerobacter thermophilus DSM
           20745]
 gi|269785814|gb|ACZ37957.1| type II secretion system protein E [Sphaerobacter thermophilus DSM
           20745]
          Length = 486

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 287/420 (68%), Gaps = 10/420 (2%)

Query: 40  SSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS 99
           SSP+A        +R   + E+KS I   LI  +D  ++   + +  R  +      ++ 
Sbjct: 56  SSPTA-------AHRNDSFNELKSRIQNRLISELD-PRMDLGNQEEVRRTVEETFASVLE 107

Query: 100 VKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETG 159
            + I ++  E+L LFE +  +ILGYGP++PL+  D +++IMVNG  +V++E NGK   T 
Sbjct: 108 AENIVLTRVERLRLFEAIAAEILGYGPIEPLLKDDTVSEIMVNGPRQVYVERNGKLELTD 167

Query: 160 INFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKF 219
           I F+D++ ++ V  RIV+ +GRR+DESSP+ DARL DGSR+N +IPP++L GPTLTIRKF
Sbjct: 168 ITFQDDDHVMRVIDRIVSPLGRRIDESSPMVDARLPDGSRINAVIPPISLVGPTLTIRKF 227

Query: 220 KKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDER 279
            +D LT + LV FG ++ E    L+     R N+++SGGTGSGKTT LN L+ +I  DER
Sbjct: 228 ARDPLTAEDLVRFGTMSEEMVTFLKACVEARLNIVVSGGTGSGKTTTLNVLSSFIPPDER 287

Query: 280 IVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEV 339
           IVT E+ AELQL+Q HVV LE+RPPNIEG GEIT+RDLV N LRMRP+RI++GE R  E 
Sbjct: 288 IVTIENAAELQLRQDHVVTLESRPPNIEGRGEITIRDLVVNALRMRPDRIVVGECRSGEA 347

Query: 340 LDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQT 399
           LD+LQAMNTGHDGSM T+H+N+ R++  R+E M  M G  LP + +RE I +++D+I+  
Sbjct: 348 LDMLQAMNTGHDGSMTTVHSNSPRDTLARLETMCLMAGVELPVRAIREQIAAAVDLIIHQ 407

Query: 400 QRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            RL+DGSR+I  + E+ GMEG+VI+ QD+  +E  G  E  K++G+   TG+ RP+F  +
Sbjct: 408 ARLKDGSRKIVAVTEVQGMEGDVIVMQDIFVFEQTGM-ENNKIVGRIKPTGI-RPKFVEK 465


>gi|152994350|ref|YP_001339185.1| type II secretion system protein E [Marinomonas sp. MWYL1]
 gi|150835274|gb|ABR69250.1| type II secretion system protein E [Marinomonas sp. MWYL1]
          Length = 455

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 275/405 (67%), Gaps = 1/405 (0%)

Query: 62  KSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDI 121
           K  I   L E ID  + S     S   +I  ++  I    ++ +S D++  +  ++ +++
Sbjct: 50  KRLIREQLYEQIDPVKASTLSHDSLNHQIEMMIRSICDTNRLQLSQDDEQAICREMFHEM 109

Query: 122 LGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGR 181
           +G GP++PL+A D + DI+VNG+ +VF+E  GK   + I F D E +L++ QRI   VGR
Sbjct: 110 VGIGPIEPLLADDSVNDILVNGAGQVFVERYGKLELSNIRFIDEEHVLNIAQRIAAAVGR 169

Query: 182 RVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGAR 241
           R+DE+ P+ DARL DGSRVN+I  PLA+DG T++IRKF +  ++L+ L   GA++ +   
Sbjct: 170 RIDETQPMVDARLADGSRVNIITYPLAIDGTTISIRKFMRRNMSLEILEQRGALSNDMVD 229

Query: 242 LLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLET 301
           +L+   + + N+++SGGTG+GKTTLLN L++ I  ++RI+T ED AELQLQQ HVVRLET
Sbjct: 230 VLRRAMQGKLNIIVSGGTGAGKTTLLNALSQKISNEDRIITIEDAAELQLQQVHVVRLET 289

Query: 302 RPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANN 361
           RP + EG G++  RDLV+N LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+H+N 
Sbjct: 290 RPVSAEGTGKVDQRDLVRNALRMRPDRIILGEVRGGESFDMLQAMNTGHDGSLCTVHSNT 349

Query: 362 ARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGN 421
            R++  R+E M+ M    LP + +R  I S++D+IVQ +R+RDGSRRI +I E+ GME +
Sbjct: 350 PRDAIMRLENMVMMASMQLPLEAIRRQIASAVDLIVQVERMRDGSRRIVSITEVCGMEDD 409

Query: 422 VIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           VI TQ+L  +E    D  G++ G+ +S+G  RP F+   + Y +E
Sbjct: 410 VIQTQELFAFETDSIDGQGRVSGRFVSSG-QRPSFYTTHSHYFDE 453


>gi|325673438|ref|ZP_08153129.1| pilus assembly protein CpaF [Rhodococcus equi ATCC 33707]
 gi|325555459|gb|EGD25130.1| pilus assembly protein CpaF [Rhodococcus equi ATCC 33707]
          Length = 465

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 268/379 (70%), Gaps = 6/379 (1%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R+E+A    EIV  +   ++ DE+  L  ++ +++LG+GPLQ L+    + +IMVN  + 
Sbjct: 74  REELA----EIVEQETTPLTFDERQRLLREVADEVLGHGPLQRLLEDPSVTEIMVNSHDM 129

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           V++E +G  V +   F D   L  V +RIV+ VGRR+DESSP+ DARL DGSRVN +IPP
Sbjct: 130 VYVERDGTLVRSSARFADEAHLRRVIERIVSAVGRRIDESSPLVDARLADGSRVNAVIPP 189

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           LA +G +LTIRKF KD   +D L++FG ++ E A LL    + R NV++SGGTG+GKTTL
Sbjct: 190 LAFNGSSLTIRKFSKDPFQVDDLIAFGTLSHEMAELLDACVQARLNVIVSGGTGTGKTTL 249

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+ +I + ERIVT ED  ELQLQQ HVVRLE+RPPNIEG+G +T+RDLV+N LRMRP
Sbjct: 250 LNVLSSFIPEGERIVTIEDAVELQLQQDHVVRLESRPPNIEGKGAVTIRDLVRNSLRMRP 309

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RI++GE RG E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E ++ M G  LP + +R
Sbjct: 310 DRIVVGECRGGESLDMLQAMNTGHDGSLSTVHANSPRDAIARLETLVLMAGMDLPLRAIR 369

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQ 445
           E I S++DVIVQ  RLRDG+RR+T++ E+ GMEG ++  QD   ++   G D  G+ +G+
Sbjct: 370 EQIASAVDVIVQLTRLRDGTRRVTHVTEVQGMEGEIVTLQDAFLFDYSAGVDARGRFLGR 429

Query: 446 HISTGVSRPRFWNRAAQYG 464
              TGV RPRF ++    G
Sbjct: 430 PQPTGV-RPRFTDKFRDLG 447


>gi|251789649|ref|YP_003004370.1| type II secretion system protein E [Dickeya zeae Ech1591]
 gi|247538270|gb|ACT06891.1| type II secretion system protein E [Dickeya zeae Ech1591]
          Length = 458

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/438 (43%), Positives = 281/438 (64%), Gaps = 8/438 (1%)

Query: 20  PLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLS 79
           P PQ   V ++       + ++ +A   + N   R  H    +  I T L ++ID  + +
Sbjct: 20  PAPQATPVKAAEAAPTETRQATAAARQPVEN---RNSH----RRLIRTQLYDLIDAGRAA 72

Query: 80  QYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADI 139
                    +I   + ++   +++ +S  E+  +  ++ +++ G GP+QPL+A D + DI
Sbjct: 73  AMSRDKLLSQIQAAIRQLCDEQRLQLSRQEEESIAGEMLDEMTGIGPIQPLLADDTVNDI 132

Query: 140 MVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSR 199
           +VNG+ +VF+E  GK   + + F D E + +  QRI   VGRR+DESSP+ DARL DGSR
Sbjct: 133 LVNGAGQVFVERFGKLELSSVTFIDEEHVFNTAQRIAAAVGRRIDESSPMVDARLPDGSR 192

Query: 200 VNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGT 259
           VNVI  PLA+DG T++IRKF +  L+L+ L S G ++   A +L    + R NV++SGGT
Sbjct: 193 VNVITYPLAIDGTTISIRKFMRRNLSLETLASQGCISPAMADVLTRAMQARLNVVVSGGT 252

Query: 260 GSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVK 319
           G+GKTTLLN L++ ID  ERI+T ED AELQLQQ HVVRLETRP + EG G++  RDL++
Sbjct: 253 GAGKTTLLNALSQNIDTRERIITIEDAAELQLQQTHVVRLETRPVSAEGGGKVDQRDLMR 312

Query: 320 NCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFT 379
           N LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+HAN  R++  R+E M+ M    
Sbjct: 313 NALRMRPDRIILGEVRGGECFDMLQAMNTGHDGSLCTVHANTTRDAIQRLENMVMMANMQ 372

Query: 380 LPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDET 439
           LP   +R  I S++ +IVQ +R+RDG RR+  + E+ GME ++I  QDL  +++ G D  
Sbjct: 373 LPLMAIRRQIASAVHLIVQIERMRDGIRRVVAVSEVCGMENDIIQMQDLFHFQIRGSDGQ 432

Query: 440 GKLIGQHISTGVSRPRFW 457
           G++ G ++ T + RP+F+
Sbjct: 433 GRITGDYVQT-IQRPQFY 449


>gi|330811033|ref|YP_004355495.1| type II/IV secretion system protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379141|gb|AEA70491.1| Putative type II/IV secretion system protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 436

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/416 (47%), Positives = 287/416 (68%), Gaps = 1/416 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           TP   E +  I+  L++++D++ L   +   A  +I  +   ++      +S   +  + 
Sbjct: 10  TPVEAEWREKIYQQLLKVMDLSLLDALEQVEAARQIRDICQRLLEEHSAPVSTVSRQLII 69

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           + + +++LG GPL+PL+A   ++DI+VNG   V++E  GK   T + FRD++ LL++  R
Sbjct: 70  KQITDEVLGLGPLEPLLADHSVSDILVNGFASVYVERFGKLQRTDVRFRDDQHLLNIIDR 129

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV+ +GRR+DESSP+ DARL DGSRVN IIPPLA+DGP+++IR+F  D L  D L+  G 
Sbjct: 130 IVSSLGRRIDESSPLVDARLKDGSRVNAIIPPLAIDGPSMSIRRFAVDLLNTDSLIQVGT 189

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T   A LL+ I R R NVLISGGTGSGKTT+LN L+ +I  +ERIVT ED+AELQLQQP
Sbjct: 190 MTPAIALLLKAIVRGRLNVLISGGTGSGKTTMLNVLSSFIPHNERIVTIEDSAELQLQQP 249

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRP NIEG GE++ R+LV+N LRMRP+RI++GEVRG E LD+L AMNTGHDGS+
Sbjct: 250 HVVRLETRPSNIEGRGEVSQRELVRNSLRMRPDRIVIGEVRGAEALDMLTAMNTGHDGSL 309

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            TIHAN AR++ GR+E M++M G T P + +R+ I S++ V++Q +R  DG RR+ ++ E
Sbjct: 310 TTIHANTARDALGRIENMVSMTGATFPIKAMRQQIASAIGVVIQLERQEDGKRRVVSMQE 369

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLA 470
           I GMEG +I   ++  +   G  E G+++G++  +G+  P F +  A+ G E  LA
Sbjct: 370 INGMEGEIITMTEIFSFVRQGIGEHGEVLGEYRPSGMI-PAFRDVLAKRGIELPLA 424


>gi|82703471|ref|YP_413037.1| type II secretion system protein E [Nitrosospira multiformis ATCC
           25196]
 gi|82411536|gb|ABB75645.1| type II secretion system protein E [Nitrosospira multiformis ATCC
           25196]
          Length = 452

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/409 (47%), Positives = 283/409 (69%), Gaps = 1/409 (0%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           P Y E+K+ +   L++ +D+  +    ++    EI  L+  ++  + + ++  E+  +  
Sbjct: 30  PAYEELKARVHQKLLDRVDLAVMESLPAERLLMEIRNLVERLLVEESVPINEAERQGIVR 89

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+ N++LG GPL+PL+A   I+DI+VN   +V++E  G+   T  +F + + L  +  RI
Sbjct: 90  DIQNEVLGLGPLEPLLADPTISDILVNTHRQVYVERRGRLELTDTHFANEKHLRKIIDRI 149

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V++VGRRVDESSP+ DARL DGSRVN IIPPLA+DG  L+IR+F    L ++ L+++ ++
Sbjct: 150 VSRVGRRVDESSPMVDARLPDGSRVNAIIPPLAIDGSLLSIRRFSVKPLKMNDLMAYKSL 209

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           T E   ++  + + +C++LISGGTGSGKTTLLN ++ +I   ERIVT ED AELQLQQPH
Sbjct: 210 TPEMGEIISGLVKGKCSILISGGTGSGKTTLLNIMSGFIPSSERIVTIEDAAELQLQQPH 269

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRPPN+EG+GEI+ R LVKN LRMRP+R+I+GEVRG E LD+LQAMNTGH+GSM 
Sbjct: 270 VVRLETRPPNVEGKGEISQRALVKNSLRMRPDRVIIGEVRGAEALDMLQAMNTGHEGSMA 329

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHAN  R++ GR+E M+ M G  LP + VR  I+S++ V++Q  RL DG R++T+I EI
Sbjct: 330 TIHANTPRDALGRVENMVNMAGLNLPIKAVRHQISSAIWVVIQVLRLTDGKRKVTSIQEI 389

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            GMEG++I  Q++  +E  G    G + G   +TG+ RP+F  R   +G
Sbjct: 390 TGMEGDIITMQEIYAFEQTGIAADGTVQGHFRATGI-RPKFAERLRVHG 437


>gi|297581611|ref|ZP_06943533.1| flp pilus assembly protein, ATPase CpaF [Vibrio cholerae RC385]
 gi|297534018|gb|EFH72857.1| flp pilus assembly protein, ATPase CpaF [Vibrio cholerae RC385]
          Length = 432

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/361 (51%), Positives = 257/361 (71%), Gaps = 3/361 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + + ++++G GP+Q L+   +++DI+VNG + V+IE  GK  +T I F D + +L+V 
Sbjct: 71  LSQQMVDEMVGIGPIQSLLDDPEVSDILVNGPDTVYIERRGKLEKTAIRFHDAKHVLNVA 130

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRIVN +GRR+DES+P+ DARL DGSRVNVI PPLAL G  ++IRKF  +KL LDHLV+ 
Sbjct: 131 QRIVNAIGRRIDESNPMVDARLADGSRVNVIAPPLALHGTCISIRKFPANKLWLDHLVNN 190

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G++T   A  L +    R N+LISGGTGSGKTTLLN L+R+I +DERI+T ED AEL L 
Sbjct: 191 GSLTQSMADFLALATYSRANILISGGTGSGKTTLLNALSRHISEDERIITIEDAAELSLM 250

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPH V LETR  + EG GE+T+RDLVKN LRMRP+RI+LGEVRG E  D+LQAMNTGHDG
Sbjct: 251 QPHWVPLETRNASTEGNGEVTVRDLVKNALRMRPDRIVLGEVRGAEAFDMLQAMNTGHDG 310

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HANN +++  R+  M+ MGG  L   ++R  I S++D++VQ +R+RDG RRIT I
Sbjct: 311 SLCTLHANNPQDAIMRLTNMLQMGGERLSDHIIRSQIVSAIDLVVQLERMRDGQRRITAI 370

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG-EEKNLAE 471
            E++G +G  I  + + ++E++G  +  K+ G + +  VS P    +AA +   EK +A 
Sbjct: 371 SEVIGFQGEQIELKPIFRFELVGAQDQ-KIQGHYRAFSVS-PALLEKAAHFAVAEKMVAS 428

Query: 472 V 472
           V
Sbjct: 429 V 429


>gi|328952512|ref|YP_004369846.1| type II secretion system protein E [Desulfobacca acetoxidans DSM
           11109]
 gi|328452836|gb|AEB08665.1| type II secretion system protein E [Desulfobacca acetoxidans DSM
           11109]
          Length = 451

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/394 (47%), Positives = 262/394 (66%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  VKS +   L+E +D+  ++    +     +   + EI +V+++ ++  E+  L  DL
Sbjct: 31  YNSVKSKVHFRLVEELDLATVTDLPREELAAAVRQTLQEITTVEQLPLNQTERSMLVSDL 90

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            N+I+G GPL+PL+A   + DI+VNG  +V++E +G    +   FRD+E L+ +  RIV 
Sbjct: 91  MNEIMGLGPLEPLMADPTVQDILVNGHAQVYVEKSGLLTLSATRFRDDEHLMQIIDRIVT 150

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            VGRRVDESSP+ DARL DGSRVNV+IPPL+L GP L+IRKF    LT++ L+   ++T 
Sbjct: 151 AVGRRVDESSPMVDARLADGSRVNVVIPPLSLCGPVLSIRKFAHQALTVEALIDNQSITP 210

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    ++   + R N+LISGGTG GKTT LN L+ +I + ERI+T ED+AEL+L QPHV+
Sbjct: 211 EIYEYMRAAIKSRLNILISGGTGVGKTTFLNILSGFIPEAERIITIEDSAELRLHQPHVI 270

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE RP N EG G +TM DLV+N LRMRP+RII+GE RG EV+D+LQAMNTGH GSM TI
Sbjct: 271 SLEARPGNTEGRGSVTMTDLVRNSLRMRPDRIIVGEARGGEVMDMLQAMNTGHPGSMSTI 330

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R +  R++ M  MG  +   + +R +I S+++VIVQ  RL DG RR+T+I E+ G
Sbjct: 331 HANSPRNALSRIQVMADMGESSFSERALRGLIASAINVIVQLNRLADGKRRVTSISEVTG 390

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           M+G  + +QD+  +E  G    G + G    TGV
Sbjct: 391 MQGETVTSQDVFVFEQHGIGARGAVYGVFQGTGV 424


>gi|116671479|ref|YP_832412.1| type II secretion system protein E [Arthrobacter sp. FB24]
 gi|116611588|gb|ABK04312.1| type II secretion system protein E [Arthrobacter sp. FB24]
          Length = 495

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 274/381 (71%), Gaps = 6/381 (1%)

Query: 85  SARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
           SAR+E    +  I+  +++ +S +E+  L +D+ +D+LGYGPLQ L+    + +IMVN  
Sbjct: 88  SAREE----LTRIIDAEQVPLSSEERTRLVQDVADDVLGYGPLQRLLDDPAVTEIMVNRM 143

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
           +++++E  G        F   E L  V +RIV++VGRR+DESSP+ DARL DGSRVN +I
Sbjct: 144 DQIYVERKGHLTLADSRFSSEEHLRKVIERIVSKVGRRIDESSPLVDARLEDGSRVNAVI 203

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
           PPLA+ G +LTIRKF K  LT+ +L+ FG +T E A LL    + + N+++SGGTG+GKT
Sbjct: 204 PPLAVGGSSLTIRKFSKVPLTVRNLIDFGTLTPEMAELLNACVKAKLNIIVSGGTGTGKT 263

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           TLLN L+ ++  DERIVT ED  ELQ+QQ HVVRLE+RPPN EG+GE+T+R+L++N LRM
Sbjct: 264 TLLNVLSSFLPSDERIVTIEDAVELQIQQAHVVRLESRPPNTEGKGEVTIRELLRNSLRM 323

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RI++GEVRG E LD+LQAMNTGHDGS+ T+H+N+ R++  R+E ++ M G  LP + 
Sbjct: 324 RPDRIVVGEVRGGESLDMLQAMNTGHDGSLSTVHSNSPRDAVARLETLVLMAGMDLPLRA 383

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLI 443
           +RE I S++++IVQ  RLRDGSRRIT++ E+ GMEG+++  QD   ++   G D  G+ +
Sbjct: 384 IREQIASAVNLIVQISRLRDGSRRITHVTEVQGMEGDIVTLQDAFVFDYSAGVDAHGRFL 443

Query: 444 GQHISTGVSRPRFWNRAAQYG 464
           G+ ++TG+ RPRF +R    G
Sbjct: 444 GRPVATGI-RPRFIDRFEDLG 463


>gi|317122045|ref|YP_004102048.1| type II secretion system protein E [Thermaerobacter marianensis DSM
           12885]
 gi|315592025|gb|ADU51321.1| type II secretion system protein E [Thermaerobacter marianensis DSM
           12885]
          Length = 458

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 203/413 (49%), Positives = 289/413 (69%), Gaps = 5/413 (1%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVS--VKKITMSLDEQLDL 113
           PH   +K+ I   LI+ +D   L + +  +  ++ A +  +I+    ++ ++S  E+ DL
Sbjct: 42  PHRA-LKNRIQLRLIDEVDARVLVRPEGPTE-EQRAAIRAKILGYLAEEESVSPLEREDL 99

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            E L  +ILGYGP++PL+   ++++IM+NG ++V++E  G+     + F D+ Q+L + +
Sbjct: 100 AETLMAEILGYGPIEPLLRDPEVSEIMINGRDQVYVERRGRLERVPVQFEDDRQILHLIE 159

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +IV  +GRR+DE+SP+ DARL DGSRVN IIPPLAL GP LTIRKF +D L +D L+  G
Sbjct: 160 KIVAPLGRRIDEASPMVDARLPDGSRVNAIIPPLALRGPCLTIRKFSRDPLGIDDLIRLG 219

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++A+ A  L+   R R N+++SGGTGSGKTT LN L+ +I  DERI+T ED AELQLQQ
Sbjct: 220 TLSAKMAVFLEAAVRGRLNIIVSGGTGSGKTTTLNVLSSFIPPDERIITIEDAAELQLQQ 279

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HVV LETRPPNIEG GE+T+R LV+N LRMRP+RI++GEVR  E LD+LQAMNTGHDGS
Sbjct: 280 EHVVSLETRPPNIEGRGEVTIRQLVRNSLRMRPDRIVVGEVRSGEALDMLQAMNTGHDGS 339

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + T HAN+ R+   R+E M+ M G  LP + +RE I S+LD+IV   R +DG+R+IT+I 
Sbjct: 340 LTTAHANSPRDLLSRLETMVLMAGIDLPVRAIREQIASALDLIVHQSRFKDGTRKITHIT 399

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           E+ GMEG+VI+ QDL +++V G D  G++ G+ ++TG+ RPR   R    G E
Sbjct: 400 EVQGMEGDVIVLQDLFRFQVHGVDTGGRVRGEFVATGI-RPRCQERLEAAGIE 451


>gi|119961569|ref|YP_948621.1| Type II/IV secretion system protein [Arthrobacter aurescens TC1]
 gi|119948428|gb|ABM07339.1| putative Type II/IV secretion system protein [Arthrobacter
           aurescens TC1]
          Length = 480

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 280/393 (71%), Gaps = 10/393 (2%)

Query: 73  IDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIA 132
           +D  +L +Y     ++E+  +++E      I ++  E+  L +++ +D+LG GPLQ  + 
Sbjct: 79  LDEAELHRY----VKEELRAVIDE----DDIPLTSQERQRLVQEIADDVLGLGPLQRFLD 130

Query: 133 RDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDA 192
             D+ +IMVNG++KV++E+ G+   T ++F   E L  + +RIV++VGRR+DESSP+ DA
Sbjct: 131 DKDVTEIMVNGADKVYVEIAGRLHLTNVHFSSEEHLRRIIERIVSKVGRRIDESSPLVDA 190

Query: 193 RLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCN 252
           RL DGSRVN IIPPLA++G +LTIRKF +  LT  +L+  G ++ E   LL    + R N
Sbjct: 191 RLSDGSRVNAIIPPLAVNGSSLTIRKFGRVPLTAQNLIQLGTMSPEITELLHACVQARLN 250

Query: 253 VLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEI 312
           +++SGGTG+GKTTLLN L+ ++  DERIVT ED  ELQLQQ HVVRLE+RP NIEG+GEI
Sbjct: 251 IIVSGGTGTGKTTLLNVLSSFLPSDERIVTIEDAVELQLQQSHVVRLESRPSNIEGKGEI 310

Query: 313 TMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAM 372
            +RDLV+N LRMRP+RI++GEVRG E LD+LQAMNTGHDGS+ T+HAN+ R++  R+E +
Sbjct: 311 AIRDLVRNSLRMRPDRIVVGEVRGGEALDMLQAMNTGHDGSISTVHANSPRDAIARLETL 370

Query: 373 IAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE 432
           + M G  LP + +RE I+S+++++VQ  RLRDG+RRIT++ E+ GMEG+V+  QD   ++
Sbjct: 371 VLMAGMDLPLRAIREQISSAVNLVVQISRLRDGTRRITHVTEVQGMEGDVVTLQDAFIFD 430

Query: 433 V-MGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
              G D  G+ +G+ + TGV RPRF +  A  G
Sbjct: 431 YSAGMDANGRFLGKPVPTGV-RPRFVDHFADLG 462


>gi|148975965|ref|ZP_01812754.1| putative Flp pilus assembly protein [Vibrionales bacterium SWAT-3]
 gi|145964710|gb|EDK29963.1| putative Flp pilus assembly protein [Vibrionales bacterium SWAT-3]
          Length = 423

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/356 (50%), Positives = 253/356 (71%), Gaps = 7/356 (1%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I+DI+VNG N +F E +GK  ++ ++F + EQLL++ 
Sbjct: 59  LVKSLIDELFGLGPLQPLVEDQSISDIIVNGPNNIFFERHGKVKKSEVSFVNEEQLLAIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRVGRRVDELSPTVDARLEDGSRVNIVIPPIALDGTSISIRKFREQNIGFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R NVLISGGTGSGKTTLLN L++YI +DERIVT ED AEL+LQ
Sbjct: 179 GSMSPDMARVLMIASRCRINVLISGGTGSGKTTLLNALSQYIAEDERIVTIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QP++VRLETR  ++E  G +T RDLV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPNLVRLETRTSSVEQTGAVTQRDLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ +IVQ  RLRDGSR+IT+I
Sbjct: 299 SMSTLHANTPRDAIARVESMVMMANLNQPLDAIRRTIVSAVQMIVQVNRLRDGSRKITSI 358

Query: 413 CEIVGMEGNVIITQDLLKYEV----MGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            EIVG+EG+ ++ +++ ++       GE+  G  +   I   + R     +A  +G
Sbjct: 359 SEIVGLEGDSVVMEEIYRFRYDDAHFGENVKGDFVTNGI---MQRSELVKKAQFFG 411


>gi|330830429|ref|YP_004393381.1| Flp pilus assembly protein, ATPase CpaF [Aeromonas veronii B565]
 gi|328805565|gb|AEB50764.1| Flp pilus assembly protein, ATPase CpaF [Aeromonas veronii B565]
          Length = 437

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/412 (46%), Positives = 276/412 (66%), Gaps = 11/412 (2%)

Query: 48  IGNFVNRTPHYYEVKSTIFT-------TLIEMIDITQLSQYDSQSARDEIATLMNEIVSV 100
            G   NR P    V+  + T          E+++ +  +     +  + +A  + ++ S 
Sbjct: 2   FGQASNRQP---PVQGALLTMSEAAREAFYELVEPSVAATLPRDALLERVANALEQLSSR 58

Query: 101 KKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGI 160
           + +  +  E L L   L ++++G GPLQPL+   +++DI+VNG +KV++E +GK V +G+
Sbjct: 59  RMLPYNRQELLLLGRQLVDEMVGVGPLQPLLDDPEVSDILVNGPDKVYVERHGKLVLSGV 118

Query: 161 NFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFK 220
            FRD + + +V QRIVN VGRRVDES+P+ DARL DGSRVNVI PP+AL G +++IRKF 
Sbjct: 119 RFRDRQHVFNVAQRIVNAVGRRVDESTPMVDARLADGSRVNVIAPPIALCGTSISIRKFP 178

Query: 221 KDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERI 280
             +LTL HLV  GA++   AR L +  R R NVLISGGTGSGKTTLLN L+++I+ DERI
Sbjct: 179 SSRLTLAHLVEKGALSDAMARFLGLAARSRFNVLISGGTGSGKTTLLNALSKHINDDERI 238

Query: 281 VTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVL 340
           +T ED AEL L+QPH V LETR  + EG+GE+++R LV+N LRMRP+RIILGEVRG E  
Sbjct: 239 ITIEDAAELSLEQPHWVPLETRNESAEGKGEVSVRALVRNALRMRPDRIILGEVRGAEAF 298

Query: 341 DLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQ 400
           D+LQAMNTGHDGS+ T+HAN   ++  R+  M+ MG   L  Q+++  I S++D++VQ +
Sbjct: 299 DMLQAMNTGHDGSLCTLHANTPEDALLRLTNMLQMGAERLSEQIIQAQIASAVDLVVQLE 358

Query: 401 RLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
           R+RDG RRIT I EI  +EG  I  Q + ++ V+  +  GKL G+ ++  +S
Sbjct: 359 RMRDGQRRITAISEITALEGGQIRMQPVFRF-VLESELHGKLQGRFMAHPLS 409


>gi|103488238|ref|YP_617799.1| type II secretion system protein E [Sphingopyxis alaskensis RB2256]
 gi|98978315|gb|ABF54466.1| type II secretion system protein E [Sphingopyxis alaskensis RB2256]
          Length = 416

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 272/398 (68%), Gaps = 1/398 (0%)

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           L++ I++TQL +        E   L+ +I++  ++ ++  E+  +  D+ +++LG GPL+
Sbjct: 7   LLDEINLTQLEKLSRAQVETEAGDLIADILNRHQLALNASERRAMVSDVLDELLGLGPLE 66

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSP 188
           PL+  + I DI+VNG + VF+E  G        F+D   L  + Q+I + VGRR+DESSP
Sbjct: 67  PLLQDETITDILVNGHDIVFVERRGLLQRVDTRFKDERHLFRIIQKIASAVGRRIDESSP 126

Query: 189 ICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR 248
             DARL DGSRVN I+PPLA+DG  L+IRKF +  + +  LV  G+V +  A +++ I R
Sbjct: 127 FVDARLADGSRVNAIVPPLAIDGSLLSIRKFARIPINMARLVELGSVPSAVAEVMEGIVR 186

Query: 249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEG 308
            R N+LISGGTGSGKTTLLN ++ +ID+ ERIVT ED+AELQLQQ HV RLETRP NIEG
Sbjct: 187 ARRNILISGGTGSGKTTLLNAISAFIDEHERIVTIEDSAELQLQQEHVARLETRPANIEG 246

Query: 309 EGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGR 368
            GE+T RDLVKN LRMRP+RII+GEVR  E  D+LQAMNTGHDGSM T+HAN AR++  R
Sbjct: 247 RGEVTQRDLVKNALRMRPDRIIVGEVRAGEAFDMLQAMNTGHDGSMTTVHANTARDALSR 306

Query: 369 MEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL 428
           +E MI M G  +P +  R  I S++++++Q  RL DG RR+ ++ EI GMEG+VI  Q++
Sbjct: 307 VEQMIGMSGIDMPPRAARGQIASAINIVIQIGRLSDGRRRLLSLSEITGMEGDVITMQEI 366

Query: 429 LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
            ++ + G D   +++G   +TG+ RP+F    + +G E
Sbjct: 367 FRFRMAGRDADNRVVGHFEATGI-RPKFLETLSAHGVE 403


>gi|239814535|ref|YP_002943445.1| type II secretion system protein E [Variovorax paradoxus S110]
 gi|239801112|gb|ACS18179.1| type II secretion system protein E [Variovorax paradoxus S110]
          Length = 457

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 284/421 (67%), Gaps = 4/421 (0%)

Query: 45  EGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKIT 104
           +G + +F + +  Y  +K  +   L++  D+  L     +  R EI+T++  ++  +   
Sbjct: 25  DGALSSFASDS--YKLLKERMHLKLLDRFDLAVLETLKPEVLRQEISTMVARLLQEEPEA 82

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           ++  E+  L  D+ +++LG+GP++ L+A   ++DI+VN  ++V++E  G+   T ++F D
Sbjct: 83  LNDIERRMLIRDIQHEMLGFGPIELLMADPTVSDILVNSHDQVYVERRGRLELTDVSFTD 142

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
            + LL +  +IV+ VGRR+DESSP+ DARL DGSRVN ++ P+ALDGP ++IR+F K  L
Sbjct: 143 EKHLLRIIDKIVSLVGRRIDESSPMVDARLPDGSRVNAVVAPVALDGPMMSIRRFAKIPL 202

Query: 225 TLDHLVS-FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTC 283
            +++LV+    +T +   +L+ +   + N+LISGGTG+GKTTLLN L+ +I   ERI+T 
Sbjct: 203 KMENLVNDLKTLTPQMGLMLEGLASAKINMLISGGTGAGKTTLLNILSGFIPATERIITI 262

Query: 284 EDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLL 343
           ED AELQLQQPHV R+ETRP NIEG+GEIT R LV+N LRMRP+RI++GEVRG E +D+L
Sbjct: 263 EDAAELQLQQPHVARMETRPMNIEGKGEITQRALVRNALRMRPDRIVIGEVRGAEAVDML 322

Query: 344 QAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLR 403
           QAMNTGH+GS+ TIHAN+ R++  R+E MI+M    LP   VR+ I S++ V++Q  R+ 
Sbjct: 323 QAMNTGHEGSLTTIHANSPRDALARLENMISMANLNLPHHSVRQQIASAITVVIQVLRMV 382

Query: 404 DGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
           DG R++T+I EI GMEG V+  Q++  +   G    G++ G   +TGV RP+F  R   +
Sbjct: 383 DGRRKVTSIQEITGMEGEVVTMQEIFAFRQTGMGPDGRVRGYFHATGV-RPKFVERLHSF 441

Query: 464 G 464
           G
Sbjct: 442 G 442


>gi|153833230|ref|ZP_01985897.1| TadA [Vibrio harveyi HY01]
 gi|148870501|gb|EDL69416.1| TadA [Vibrio harveyi HY01]
          Length = 423

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 255/353 (72%), Gaps = 4/353 (1%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I+DIMVNG N +F E +GK  ++ ++F + EQLL++ 
Sbjct: 59  LVKSLIDELFGLGPLQPLVEDQSISDIMVNGPNNIFFERHGKVQKSEVSFVNEEQLLAIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRVGRRVDELSPTVDARLEDGSRVNIVIPPIALDGTSISIRKFREQNIGFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R NVLISGGTGSGKTTLLN L++YI +DERIVT ED AEL+LQ
Sbjct: 179 GSMSPDMARVLMIASRCRMNVLISGGTGSGKTTLLNALSQYIAEDERIVTIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QP++VRLETR  ++E  G +  RDLV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPNLVRLETRTSSVEQTGAVNQRDLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ +IVQ  RLRDGSR+IT+I
Sbjct: 299 SMSTLHANTPRDAIARVESMVMMANLNQPLDAIRRTIVSAVQMIVQVNRLRDGSRKITSI 358

Query: 413 CEIVGMEGNVIITQDL--LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
            EIVG+EG+ ++ +++   +Y+     ET K  G  +++G+ +     + AQ+
Sbjct: 359 SEIVGLEGDSVVMEEIYRFRYDDTHFGETVK--GDFVTSGIMQRSELVKKAQF 409


>gi|15602714|ref|NP_245786.1| hypothetical protein PM0849 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721158|gb|AAK02933.1| TadA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 425

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/412 (46%), Positives = 280/412 (67%), Gaps = 8/412 (1%)

Query: 69  LIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGP 126
           L+  +DI ++ +  S+  +  DE+  ++ ++     I ++  + L + E + ++I GYGP
Sbjct: 14  LLSNLDIEKIDEIQSERDKLVDELVQVVYKVAGKGNIYITSADALFMAECIADEIDGYGP 73

Query: 127 LQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDES 186
           ++ L+  + + DI+VNG + V++E  G   +T   F  NEQL  + +R+V +VGRR+D+ 
Sbjct: 74  IRELMEDETVNDILVNGPDDVWVERAGILEKTDKKFISNEQLTDIAKRLVAKVGRRIDDG 133

Query: 187 SPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQII 246
           SP+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV+FG++T E A  L I 
Sbjct: 134 SPLVDSRLPDGSRLNVVIAPIALDGTSISIRKFSKSKKSLQELVNFGSMTREMANFLIIA 193

Query: 247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNI 306
            R R N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +
Sbjct: 194 ARSRVNIIVSGGTGSGKTTLLNALSNYISPKERVITLEDTAELRLEQPHVVRLETRLAGV 253

Query: 307 EGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESF 366
           E  GEITM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R++ 
Sbjct: 254 ERTGEITMQDLVINALRMRPERIIVGECRGGEAFQMLQAMNTGHDGSMSTLHANSPRDAT 313

Query: 367 GRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQ 426
            R+E+M+ M   +LP + +R  I S++++IVQ  RL DGSR+I NI E++GME   I+ Q
Sbjct: 314 ARLESMVMMSNASLPLEAIRRNIASAVNIIVQASRLNDGSRKIMNITELMGMENGQIVMQ 373

Query: 427 DLLKYE-VMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSL 476
           D+  Y+     DE GK+ G+ IS G ++R   +  A  +    NL+  LQS+
Sbjct: 374 DIFSYQPSKYRDENGKITGEFISHGLLTRSVVYQNAQVF----NLSAELQSI 421


>gi|220913393|ref|YP_002488702.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
 gi|219860271|gb|ACL40613.1| type II secretion system protein E [Arthrobacter chlorophenolicus
           A6]
          Length = 498

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/372 (49%), Positives = 270/372 (72%), Gaps = 2/372 (0%)

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           +  I+  +++ ++ +E+  L  D+ +D+LGYGPLQ L+    + +IMVN  +++++E  G
Sbjct: 107 LTRIIDAEQVPLTPEERTRLVRDVADDVLGYGPLQRLLDDSAVTEIMVNRMDQIYVERGG 166

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           +   T   F   + L  V +RIV++VGRR+DESSP+ DARL DGSRVN +IPPLA+ G +
Sbjct: 167 RLTLTDYRFSSEDHLRKVIERIVSRVGRRIDESSPLVDARLEDGSRVNAVIPPLAVGGSS 226

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           LTIRKF K  LT+ +L+ FG +T E A LL    + + N+++SGGTG+GKTTLLN L+ +
Sbjct: 227 LTIRKFSKVPLTVRNLIDFGTLTPEMAELLNACVKAKLNIIVSGGTGTGKTTLLNVLSSF 286

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           +  DERIVT ED  ELQ+QQ HVVRLE+RPPN EG+GE+T+R+L++N LRMRP+RI++GE
Sbjct: 287 LPADERIVTIEDAVELQIQQQHVVRLESRPPNTEGKGEVTIRELLRNSLRMRPDRIVVGE 346

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
           VRG E LD+LQAMNTGHDGS+ T+H+N+ R++  R+E ++ M G  LP + +RE I S++
Sbjct: 347 VRGGESLDMLQAMNTGHDGSLSTVHSNSPRDAVARLETLVLMAGMDLPLRAIREQIASAV 406

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVS 452
           ++IVQ  R+RDGSRRIT++ E+ GMEG+++  QD   ++   G D  G+ +G+ I+TG+ 
Sbjct: 407 NLIVQISRMRDGSRRITHVTEVQGMEGDIVTLQDAFVFDYAAGVDAQGRFLGKPIATGI- 465

Query: 453 RPRFWNRAAQYG 464
           RPRF +R    G
Sbjct: 466 RPRFIDRFEDLG 477


>gi|84385681|ref|ZP_00988712.1| putative Flp pilus assembly protein [Vibrio splendidus 12B01]
 gi|84379661|gb|EAP96513.1| putative Flp pilus assembly protein [Vibrio splendidus 12B01]
          Length = 423

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/353 (50%), Positives = 256/353 (72%), Gaps = 4/353 (1%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I+DIMVNG N +F E +GK  ++ ++F + EQLL++ 
Sbjct: 59  LVKSLIDELFGLGPLQPLVEDQSISDIMVNGPNNIFFERHGKVKKSEVSFVNEEQLLAIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDE SP  DARL DGSRVN++IPP++LDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRVGRRVDELSPTVDARLEDGSRVNIVIPPISLDGTSISIRKFREQNIGFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R NVLISGGTGSGKTTLLN L++YI +DERIVT ED AEL+LQ
Sbjct: 179 GSMSPDMARVLMIASRCRINVLISGGTGSGKTTLLNALSQYIAEDERIVTIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QP++VRLETR  ++E  G +T R+LV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPNLVRLETRTSSVEQTGAVTQRELVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ +IVQ  RLRDGSR+IT+I
Sbjct: 299 SMSTLHANTPRDAIARVESMVMMANLNQPLDAIRRTIVSAVQMIVQVNRLRDGSRKITSI 358

Query: 413 CEIVGMEGNVIITQDL--LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
            EIVG+EG+ ++ +++   +Y+     ET K  G+ ++ G+ +     + AQ+
Sbjct: 359 SEIVGLEGDSVVMEEIYRFRYDDAHYGETVK--GEFVTDGIMQRSELVKKAQF 409


>gi|226310157|ref|YP_002770051.1| hypothetical protein BBR47_05700 [Brevibacillus brevis NBRC 100599]
 gi|226093105|dbj|BAH41547.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 462

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/409 (44%), Positives = 272/409 (66%), Gaps = 1/409 (0%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           P+  E+     T L+   ++ +L+   S   R  I  L+++ +S +K+ +  +E+  L  
Sbjct: 33  PYIDELAEHYKTRLLRETNLERLTSLGSDEMRLAIERLVSQYMSEEKVVIPRNEKDILLT 92

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            L N+ +G GPL+PL+A  +I +I +NG N V++E  G+   T + FRD E L  +  RI
Sbjct: 93  RLINESVGLGPLEPLLADPEITEISINGHNLVYVEKRGRLELTDLKFRDEEHLRHIVDRI 152

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V  +GRR+DESSP+ DARL DGSRVN +IPP++L+G  ++IRKF+K+   +D L+ FG+ 
Sbjct: 153 VAPLGRRIDESSPMVDARLKDGSRVNAVIPPISLNGTLVSIRKFRKEPFLMDDLMQFGSF 212

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           +   ++ +Q +   + NVLISGGTGSGKTTLLN   + I   ER++T ED+AEL+L  P+
Sbjct: 213 SEAMSQFIQAVVEAKMNVLISGGTGSGKTTLLNATAKAIPHYERVITIEDSAELKLTHPN 272

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
            + +E RPPN+EG GE+T+R LV+N LRMRP+RII+GEVRGPE  D+LQAMNTGH+GS+ 
Sbjct: 273 CIGMEARPPNMEGTGEVTIRQLVRNSLRMRPDRIIVGEVRGPEAFDMLQAMNTGHEGSLT 332

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HAN+ +++F R+E M+ M G  LPS +VRE I S+LD+IVQ  RL DG+R+I +I E+
Sbjct: 333 TVHANSPQDAFNRLEGMVVMAGMDLPSSIVREYIVSALDIIVQVTRLSDGTRKIVSISEV 392

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
              E   +   ++ +++  G    G+++G   +TGV  PR   R   +G
Sbjct: 393 AKTEDKRVEVNEIFRFQRKGIGAKGEVLGYFTATGVI-PRCLERLQVFG 440


>gi|149188860|ref|ZP_01867150.1| putative Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837280|gb|EDL54227.1| putative Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 423

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/365 (48%), Positives = 254/365 (69%), Gaps = 1/365 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I DIMVNG N +F E +GK  ++ + F + EQ+L++ 
Sbjct: 59  LVKSLMDELFGLGPLQPLVEDQSITDIMVNGPNNIFFERHGKVQKSEVTFVNEEQVLAIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRVGRRVDELSPTVDARLEDGSRVNIVIPPIALDGTSISIRKFREQNIGFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ + AR+L I  R R NVLISGGTGSGKTTLLN L++YI +DERI+T ED AEL+LQ
Sbjct: 179 GSMSLDMARVLMIASRCRINVLISGGTGSGKTTLLNALSQYIAEDERIITIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QP++VRLETR  +IE  G +T RDLV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPNLVRLETRTSSIEQTGAVTQRDLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ ++VQ  RLRDGSR++T+I
Sbjct: 299 SMSTLHANTPRDAIARVESMVMMANLNQPLDAIRRTIVSAVQMVVQVNRLRDGSRKVTSI 358

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNLAE 471
            EIVG+EG+ ++ +++ ++          + G  ++ G+  R     +A  +G   +L  
Sbjct: 359 SEIVGLEGDSVVMEEIYRFRYDDAHYGEAVKGDFVTNGIMQRSELVKKAQFFGLYDDLMA 418

Query: 472 VLQSL 476
             + L
Sbjct: 419 SFKGL 423


>gi|312882147|ref|ZP_07741896.1| flp pilus assembly ATPase CpaF [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370193|gb|EFP97696.1| flp pilus assembly ATPase CpaF [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 423

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/351 (50%), Positives = 250/351 (71%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I+DIMVNG + +F E +GK  ++ ++F + EQLL++ 
Sbjct: 59  LVKSLIDELFGLGPLQPLVEDQSISDIMVNGPDNIFFERHGKVQKSEVSFVNEEQLLAIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI ++VGRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRVGRRVDELSPTVDARLDDGSRVNIVIPPIALDGTSISIRKFREQNIDFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ E AR+L I  R R N+LISGGTGSGKTTLLN L+ YI +DERIVT ED AEL+LQ
Sbjct: 179 GSMSPEMARILMIASRCRMNILISGGTGSGKTTLLNALSNYIAEDERIVTIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QP++VRLETR  ++E  G IT RDLV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 QPNLVRLETRTSSVEQTGAITQRDLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ +IVQ  RLRDGSR+IT+I
Sbjct: 299 SMSTLHANTPRDAISRVESMVMMANLNQPLDAIRRTIVSAVQMIVQVNRLRDGSRKITSI 358

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
            EI+G+EG+ ++ +++  +        G + G   + G+ +     + AQ+
Sbjct: 359 SEIIGLEGDNVVLEEIYNFRFDDAHFGGTVKGDFFTNGLMQRSELVKKAQF 409


>gi|330819177|ref|YP_004348039.1| FHA domain containing protein [Burkholderia gladioli BSR3]
 gi|327371172|gb|AEA62527.1| FHA domain containing protein [Burkholderia gladioli BSR3]
          Length = 597

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 269/401 (67%), Gaps = 4/401 (0%)

Query: 60  EVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD-LFED 116
           E++ T+   LI  +D+ +L  ++ D    R  +   ++EI+       S D  L+ L + 
Sbjct: 174 ELRKTVHMRLIAELDLRRLNVARMDDDELRRTVGGALDEILDNDAAFRSADVSLEALRKS 233

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ++++G GPL+ LIA  ++++IMVN  +++F+E  GK   + + F D+  +L   +RIV
Sbjct: 234 VFDEVIGLGPLEELIADPEVSEIMVNCHDEIFVERRGKLTRSRVIFTDDRAVLGAIERIV 293

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
             +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++TIRKF + KLT + L+ FG+++
Sbjct: 294 APIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSQRKLTGEDLIDFGSMS 353

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
           A+    L+     R N++ISGGTGSGKTTLLN L+ YI  DERIVT ED AELQL QP++
Sbjct: 354 ADMLAFLRTAVEQRANIIISGGTGSGKTTLLNVLSNYIPDDERIVTVEDAAELQLSQPNL 413

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           V LE RPPN+EG+G + +RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTGHDGS+ T
Sbjct: 414 VALEARPPNMEGKGAVPIRDLVKNCLRMRPDRIVVGECRGGEALDMLQAMNTGHDGSLTT 473

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
            HAN+ R+   R+E M  M G  LP Q +RE I S++D+IVQ  R   GSRR+T++ E+ 
Sbjct: 474 AHANSPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDIIVQQTRFSCGSRRVTHVTEVS 533

Query: 417 GMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           GME  VI  QD+  +   G  E G++ G    T    P F+
Sbjct: 534 GMESGVIQLQDVFVFRQDGFGEDGRVQGVFHPTSYV-PDFY 573


>gi|296158515|ref|ZP_06841345.1| FHA domain containing protein [Burkholderia sp. Ch1-1]
 gi|295891083|gb|EFG70871.1| FHA domain containing protein [Burkholderia sp. Ch1-1]
          Length = 638

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/407 (46%), Positives = 268/407 (65%), Gaps = 4/407 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           +P   E++      +I  +D+ +L  ++ +    R  +   +++I++      + D  L 
Sbjct: 215 SPLGIELRKQAHMKVISALDLRRLNVARMEEDELRKTVGAALDDILNHDVSFQTADIPLS 274

Query: 113 -LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            L + + ++I+G GPL+ LIA   +++IMVN  N++FIE NG+   + + F D+  +L  
Sbjct: 275 ALKKSVFDEIIGLGPLEELIADPTVSEIMVNCHNEIFIEQNGQLTRSPVIFTDDRAVLGA 334

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++TIRKF + KL  + L+ 
Sbjct: 335 IERIVAPIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSRQKLGGEDLIR 394

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG+++A+    L    +   N++ISGGTGSGKTTLLN L+ YI  DERIVT ED AELQL
Sbjct: 395 FGSMSADMLEFLHTAVKEGANIVISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQL 454

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QP++V LE RP N+EG+G I +RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTGHD
Sbjct: 455 SQPNLVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHD 514

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ T HAN  R+   R+E M  M G  LP Q +RE I S++D+IVQ  R   GSRR+T+
Sbjct: 515 GSLTTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDIIVQQSRFSCGSRRVTH 574

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWN 458
           + E+ GME  VI  QD+  ++  G  E GK+ G+ + T    P F+ 
Sbjct: 575 VTEVSGMESGVITLQDVFVFKEEGFSEHGKIQGKFVPTAYV-PDFYQ 620


>gi|145299825|ref|YP_001142666.1| flp pilus assembly protein FlpF [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866589|gb|ABD57357.1| FlpF [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852597|gb|ABO90918.1| flp pilus assembly protein FlpF [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 437

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/340 (53%), Positives = 249/340 (73%), Gaps = 1/340 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L   L ++++G GPLQPL+   +++DI+VNG +KV++E +GK   +G+ FRD + + +V 
Sbjct: 71  LARQLVDEMVGVGPLQPLLDDPEVSDILVNGPDKVYVERHGKLTLSGVRFRDRQHVFNVA 130

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           QRIVN VGRRVDES+P+ DARL DGSRVNVI PP+AL G T++IRKF   +LTL HLV  
Sbjct: 131 QRIVNAVGRRVDESTPMVDARLADGSRVNVIAPPVALCGTTISIRKFPSSRLTLTHLVEK 190

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++   AR L +  R R N+LISGGTGSGKTTLLN L+++I+ DERI+T ED AEL L 
Sbjct: 191 GALSDAMARFLGLAARSRFNLLISGGTGSGKTTLLNALSKHINDDERIITIEDAAELSLD 250

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPH V LETR  + EG+GE+++R LV+N LRMRP+RIILGEVRG E  D+LQAMNTGHDG
Sbjct: 251 QPHWVPLETRNESAEGKGEVSVRALVRNALRMRPDRIILGEVRGAEAFDMLQAMNTGHDG 310

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T+HAN   ++  R+  M+ MG   L  Q+++  I S++D++VQ +R+RDG RRIT I
Sbjct: 311 SLCTLHANTPEDALLRLTNMLQMGAERLSEQIIQAQIASAVDLVVQLERMRDGQRRITAI 370

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS 452
            E+  +EG+ I  Q L ++ V+G +  GKL G+ I+  +S
Sbjct: 371 SEVTSLEGSQIRMQPLFRF-VLGSELHGKLQGRFIAHPLS 409


>gi|323341958|ref|ZP_08082191.1| pilus assembly protein CpaF [Erysipelothrix rhusiopathiae ATCC
           19414]
 gi|322464383|gb|EFY09576.1| pilus assembly protein CpaF [Erysipelothrix rhusiopathiae ATCC
           19414]
          Length = 454

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/366 (48%), Positives = 258/366 (70%), Gaps = 1/366 (0%)

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           ++  ++ E ++ +   M+  ++  L +++ +D+ G GPL+ LI  +DI++IMVNG N V+
Sbjct: 70  DVREIITECLTQRAEAMTKAKREQLIQEIFDDVTGLGPLEVLIRDEDISEIMVNGPNTVY 129

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           IE  G+   + + FRD+  +  +  RIV+ +GRR DE++P+ DARL DGSRVN I+PP+A
Sbjct: 130 IERKGRLELSNVFFRDDAHVAQIINRIVSPLGRRCDEANPMVDARLPDGSRVNAIVPPVA 189

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           L GPT+TIRKF    L +  L+ F +++   A  L+   + RCNV++SGGTGSGKTTLLN
Sbjct: 190 LSGPTITIRKFNSTPLQISDLIGFNSISFGMAAFLEACVKGRCNVVVSGGTGSGKTTLLN 249

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L+ +I + ERIVT ED AE+QL Q HV+ LE RP N+EG+G +T+RD+VKN LRMRP+R
Sbjct: 250 VLSSFIPETERIVTIEDAAEIQLMQNHVITLEARPANVEGKGAVTIRDMVKNSLRMRPDR 309

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           II+GEVR  E LD+LQAMNTGHDGS+ T HAN  R+   R+E M+ M G  LP + +RE 
Sbjct: 310 IIIGEVRSGEALDMLQAMNTGHDGSLATGHANTPRDMVSRLETMVMMSGMDLPIKAIREQ 369

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIS 448
           I+S++++IVQ  RLRDGSR++  I E+ GMEG ++  QD+  ++  G D  GK+ G+ ++
Sbjct: 370 ISSAINIIVQQTRLRDGSRKVVAITEVTGMEGEIVTLQDIFVFKQEGYDAAGKVKGKFMA 429

Query: 449 TGVSRP 454
           TG+ RP
Sbjct: 430 TGI-RP 434


>gi|91777216|ref|YP_552424.1| type II/IV secretion system protein E [Burkholderia xenovorans
           LB400]
 gi|91689876|gb|ABE33074.1| type II/IV secretion system protein E [Burkholderia xenovorans
           LB400]
          Length = 638

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/406 (46%), Positives = 268/406 (66%), Gaps = 4/406 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           +P   E++      +I  +D+ +L  ++ +    R  ++  +++I++      + D  L 
Sbjct: 215 SPLGIELRKQAHMKVIAALDLRRLNVARMEEDELRKTVSAALDDILNHDASFHTADIPLS 274

Query: 113 -LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            L + + ++I+G GPL+ LIA   +++IMVN  N++FIE NG+   + + F D+  +L  
Sbjct: 275 ALKKSVFDEIIGLGPLEELIADPTVSEIMVNCHNEIFIEQNGQLTRSPVIFTDDRAVLGA 334

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++TIRKF + KL  + L+ 
Sbjct: 335 IERIVAPIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSRQKLGGEDLIR 394

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG+++ +    L    +   N++ISGGTGSGKTTLLN L+ YI  DERIVT ED AELQL
Sbjct: 395 FGSMSPDMLEFLHTAVKEGANIVISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQL 454

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QP++V LE RP N+EG+G I +RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTGHD
Sbjct: 455 SQPNLVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHD 514

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ T HAN  R+   R+E M  M G  LP Q +RE I S++D+IVQ  R   GSRR+T+
Sbjct: 515 GSLTTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDLIVQQSRFSCGSRRVTH 574

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           + E+ GME  VI  QD+  ++  G  E GK+ G+ + T    P F+
Sbjct: 575 VTEVSGMESGVITLQDVFVFKEEGFSEHGKIQGKFVPTAYV-PDFY 619


>gi|323529158|ref|YP_004231310.1| FHA domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323386160|gb|ADX58250.1| FHA domain containing protein [Burkholderia sp. CCGE1001]
          Length = 637

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/422 (45%), Positives = 272/422 (64%), Gaps = 9/422 (2%)

Query: 39  SSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNE 96
           ++ PSA   I      TP   E++      +I  +D+ +L  ++ +    R  +   +++
Sbjct: 203 AAEPSAIAPIN-----TPLGIELRKQAHMKVIAALDLRRLNVARMEDDELRKTVGAALDD 257

Query: 97  IVSVKKITMSLDEQLDLFE-DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKT 155
           I++   +  + D  LD+ +  + ++I+G GPL+ LIA   +++IMVN  N++F+E +G+ 
Sbjct: 258 ILNHDPMFRTPDIPLDVLKKSVFDEIIGLGPLEELIADPSVSEIMVNCHNEIFVEQDGQL 317

Query: 156 VETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLT 215
             + + F D+  +L   +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++T
Sbjct: 318 TRSPVIFTDDRAVLGAIERIVAPIGRRIDESSPMVDARLADGSRVNAVIPPLALKGPSIT 377

Query: 216 IRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYID 275
           IRKF + KL  + L+ +G ++      L    +   N++ISGGTGSGKTTLLN L+ YI 
Sbjct: 378 IRKFSRRKLVGEDLIRYGTLSPHMLEFLHTAVKQGANIIISGGTGSGKTTLLNVLSSYIP 437

Query: 276 KDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVR 335
            DERIVT ED AELQL QP++V LE RP N+EG+G + +RDLVKNCLRMRP+RI++GE R
Sbjct: 438 DDERIVTVEDAAELQLSQPNLVSLEARPANMEGKGAVNIRDLVKNCLRMRPDRIVIGECR 497

Query: 336 GPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDV 395
           G E LD+LQAMNTGHDGS+ T HAN  R+   R+E M  M G  LP   +RE I S++D+
Sbjct: 498 GGEALDMLQAMNTGHDGSLTTAHANTPRDCIARLEVMTLMAGLDLPVHAIREQICSAVDI 557

Query: 396 IVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPR 455
           IVQ  R   GSRR+T+I E+ GME  VI  QD+  ++  G  E GK+ G+ + T    P 
Sbjct: 558 IVQQSRFSCGSRRVTHITEVSGMESGVITLQDVFVFKEEGFSEQGKIQGKFVPTAYV-PD 616

Query: 456 FW 457
           F+
Sbjct: 617 FY 618


>gi|319783871|ref|YP_004143347.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169759|gb|ADV13297.1| type II secretion system protein E [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 473

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/398 (47%), Positives = 266/398 (66%), Gaps = 1/398 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           + +  I   L+E I++  L +      R ++   ++E    +++ ++  E   L +D+ +
Sbjct: 55  DARVRIHRLLLEEINLVALERLPKDEMRRQVHDFVSEKTKQERMAINTVELDALVDDIVD 114

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           +++G GPL+PL+   DI DI++NG    F+E  GK     I F+D   LL +  +IV  V
Sbjct: 115 EMVGLGPLEPLLKDPDINDILINGHMNCFVEKKGKLQPVHIPFKDEAHLLRIVNKIVAAV 174

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES P+ DAR+LDGSR N  I P+A+DGP ++IRKF K+KL L  LV FGA+T   
Sbjct: 175 GRRVDESQPMVDARMLDGSRFNAAIRPVAVDGPLVSIRKFSKNKLGLHKLVEFGAITQNM 234

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A +L      R   +ISGGTG+GKTT+LN L+ +I +DER++T ED AELQLQQPHV R+
Sbjct: 235 AEVLAAAVHARKTTIISGGTGTGKTTMLNALSAFIPEDERLITIEDAAELQLQQPHVARM 294

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP NIEG GE+  RDLVKN LRMRP+R+ILGE RG E  D+LQAMNTGH+GSM TIHA
Sbjct: 295 ETRPANIEGHGELKQRDLVKNALRMRPDRVILGECRGEEAFDMLQAMNTGHEGSMATIHA 354

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E M+ M G  +  Q +R  I S+LD+IVQ  RL DG R++T++ E+ GME
Sbjct: 355 NTPRDAISRLEQMLGMTGMPMTVQSIRSQIASALDLIVQLTRLSDGKRKVTSVAEVTGME 414

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           G+VI  Q++ ++   G +  GK++G + +TG+ RPRF 
Sbjct: 415 GDVIQMQEIFRFVRTGMEADGKILGHYEATGI-RPRFL 451


>gi|307726636|ref|YP_003909849.1| FHA domain containing protein [Burkholderia sp. CCGE1003]
 gi|307587161|gb|ADN60558.1| FHA domain containing protein [Burkholderia sp. CCGE1003]
          Length = 633

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/450 (44%), Positives = 288/450 (64%), Gaps = 13/450 (2%)

Query: 15  REDNNPLPQEVVVSSSNIQKQNLQSSSP----SAEGEIGNFVNRTPHYYEVKSTIFTTLI 70
           RE+     Q+ V + S      L SS+P    +AE      +N +P   E++      +I
Sbjct: 171 REETARREQQAVAAPSG----TLSSSAPVGKTTAEPLTIAPIN-SPLGIELRKQAHMKVI 225

Query: 71  EMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD-LFEDLCNDILGYGPL 127
             +D+ +L  ++ +    R  ++  +++I++   +  + D  L+ L + + ++I+G GPL
Sbjct: 226 AALDLRRLNVARMEDDELRKTVSAALDDILNHDPMFRTPDIPLETLKKSVFDEIIGLGPL 285

Query: 128 QPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESS 187
           + LI+   +++IMVN  N++F+E +G+   + + F D+  +L   +RIV  +GRR+DESS
Sbjct: 286 EELISDPTVSEIMVNCHNEIFVEKDGQLTRSPVIFTDDRAVLGAIERIVAPIGRRIDESS 345

Query: 188 PICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIG 247
           P+ DARL DGSRVN +IPPLAL GP++TIRKF + KLT + L+ FG ++      L+   
Sbjct: 346 PMVDARLADGSRVNAVIPPLALKGPSITIRKFSRRKLTGEDLIRFGTLSPHMLEFLRTAV 405

Query: 248 RIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIE 307
           +   N++ISGGTGSGKTTLLN L+ YI  DERIVT ED AELQL QP++V LE RP N+E
Sbjct: 406 KQGANIIISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQLSQPNLVSLEARPANME 465

Query: 308 GEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFG 367
           G+G + +RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTGHDGS+ T HAN  R+   
Sbjct: 466 GKGAVPIRDLVKNCLRMRPDRIVVGECRGGEALDMLQAMNTGHDGSLTTAHANTPRDCIA 525

Query: 368 RMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQD 427
           R+E M  M G  LP Q +RE I S++D++VQ  R   GSRR+T+I E+ GME  VI  QD
Sbjct: 526 RLEVMTLMAGLDLPVQAIREQICSAVDIVVQQSRFSCGSRRVTHITEVSGMESGVITLQD 585

Query: 428 LLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           +  ++  G  E GK+ G+ + T    P F+
Sbjct: 586 VFVFKEEGFSEQGKIQGKFVPTAYI-PDFY 614


>gi|283769333|ref|ZP_06342232.1| type II/IV secretion system protein [Bulleidia extructa W1219]
 gi|283103990|gb|EFC05374.1| type II/IV secretion system protein [Bulleidia extructa W1219]
          Length = 454

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 265/395 (67%), Gaps = 1/395 (0%)

Query: 70  IEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQP 129
           +E++D        S S +DE+  L+  IV      +S   +  L E++ ++ +G GPL+ 
Sbjct: 46  LELLDRINYGVSISASQKDEVYDLVKSIVESLGSDISRPIRNRLVEEIFDETIGLGPLER 105

Query: 130 LIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPI 189
           L+   D+ +IMVNG  +V++E  GK   + + F+D+  +L+V  RI++ +GRR DES+P+
Sbjct: 106 LLKDPDVTEIMVNGPEQVYVERQGKISLSDVKFKDSGAVLTVIDRIISPLGRRCDESTPM 165

Query: 190 CDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRI 249
            DARL DGSRVN IIPP++L GP++TIRKF K    +  L+ F +++ + A  L+   + 
Sbjct: 166 VDARLPDGSRVNAIIPPVSLVGPSITIRKFSKKGFEVSDLIRFNSLSYQMAAFLEACVKG 225

Query: 250 RCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGE 309
           + N+++ GGTGSGKTTLLN L+ +I ++ERIVT ED AELQL+QPH V LE RP N+EG 
Sbjct: 226 KANIIVFGGTGSGKTTLLNTLSGFIPENERIVTIEDAAELQLKQPHKVILEARPANVEGR 285

Query: 310 GEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRM 369
           GEI +RDLVKN LRMRP+RI++GEVR  E LD+LQAMNTGHDGS+ T HAN +R+   R+
Sbjct: 286 GEIAIRDLVKNALRMRPDRIVVGEVRSGEALDMLQAMNTGHDGSLTTAHANTSRDLLSRL 345

Query: 370 EAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLL 429
           E M+ M G  LPS+ +RE I S+ +++V   RLRDG+R+I  I E+VGME + I+ QD+ 
Sbjct: 346 ETMVLMAGMGLPSRAIREQIASAFNILVHQSRLRDGTRKIMAISEVVGMEEDTILLQDIF 405

Query: 430 KYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            ++  G D  G + G ++ TG+ RP+   R    G
Sbjct: 406 TFKQEGFDSNGHIHGSYVPTGI-RPKILQRIMDEG 439


>gi|163801674|ref|ZP_02195572.1| putative Flp pilus assembly protein [Vibrio sp. AND4]
 gi|159174591|gb|EDP59393.1| putative Flp pilus assembly protein [Vibrio sp. AND4]
          Length = 423

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/353 (50%), Positives = 252/353 (71%), Gaps = 4/353 (1%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L + L +++ G GPLQPL+    I+DIMVNG + +F E +GK  ++ I F + EQLLS+ 
Sbjct: 59  LVKSLIDELFGLGPLQPLVEDQSISDIMVNGPDNIFFERHGKVQKSDITFVNEEQLLSIA 118

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI +++GRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++  +  + L+ F
Sbjct: 119 KRIASRIGRRVDELSPTVDARLEDGSRVNIVIPPIALDGTSISIRKFREQNIGFEDLIGF 178

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++ + AR+L I  R R N+LISGGTGSGKTTLLN L++YI +DERI+T ED AEL+LQ
Sbjct: 179 GAMSQDMARVLMIASRCRMNILISGGTGSGKTTLLNALSQYIAEDERILTIEDAAELRLQ 238

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
            P++VRLETR  ++E  G +  RDLV N LRMRP+RIILGE RG E  ++LQAMNTGHDG
Sbjct: 239 IPNLVRLETRASSVEQTGAVNQRDLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDG 298

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+M+ M     P   +R  I S++ +IVQ  RLRDGSR+IT+I
Sbjct: 299 SMSTLHANTPRDAIARVESMVMMANLGQPLDAIRRTIVSAVHLIVQVNRLRDGSRKITSI 358

Query: 413 CEIVGMEGNVIITQDL--LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
            EIVGMEG+ ++ +++   +Y+     ET K  G  ++ G+ +     + AQ+
Sbjct: 359 SEIVGMEGDSVVMEEIYRFRYDDAHFGETVK--GDFVTDGIMQRSELVKKAQF 409


>gi|149175456|ref|ZP_01854077.1| type II secretion system protein E [Planctomyces maris DSM 8797]
 gi|148845724|gb|EDL60066.1| type II secretion system protein E [Planctomyces maris DSM 8797]
          Length = 453

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/393 (45%), Positives = 265/393 (67%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K+ +   +++ ID ++  +   +  R ++  L   +   + I +    +  +  ++
Sbjct: 20  FQRLKTKLHHQMVDAIDFSKAGELPEEDLRIKLRGLAEHLCMQQDIALDQTNRDIMVREI 79

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++I G+GPL+PL+   +I+D++VNG+++VFIE NG   ET I+F D+E LL +  R+V 
Sbjct: 80  LDEIYGFGPLEPLMNDPEISDVLVNGADRVFIERNGLLEETDISFADDEHLLQLIHRLVG 139

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           + GRR+DE SP+ DA+L DGSR+N +IPPLAL GPTL+IR+F+   L  D +V   ++  
Sbjct: 140 RAGRRIDEVSPMVDAKLPDGSRLNAVIPPLALKGPTLSIRRFRTQALLFDDMVKKRSLAP 199

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           + AR L++    R N+LISGGTG+GKTTLLN L+RYI   ERIVT E TAELQLQQP VV
Sbjct: 200 DMARFLEMAVHGRLNILISGGTGAGKTTLLNNLSRYISAKERIVTIEQTAELQLQQPDVV 259

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LE RP NIEG+GEI  RDL+KN LRMRP+R+I+GE RG EVL++LQAMNTGHDGSM T+
Sbjct: 260 SLEARPSNIEGQGEINQRDLLKNSLRMRPDRVIVGESRGGEVLEMLQAMNTGHDGSMSTV 319

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E MIA+ G  LP+ + R  I S++ ++V   RL +G R++  I E++G
Sbjct: 320 HANDTRDALDRLELMIALSGAELPNSIARRYIASAVHLLVHISRLPNGERKVMRISELIG 379

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTG 450
            +    + +DL  + +   ++ G++ G   +TG
Sbjct: 380 FQNGEYMVEDLFVFRITSVEKNGQVNGAFYATG 412


>gi|116626774|ref|YP_828930.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229936|gb|ABJ88645.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 438

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/407 (43%), Positives = 273/407 (67%), Gaps = 1/407 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           ++E+KS +   L+  +   QL      S R ++ +++ +++  + + M++ E+  L E++
Sbjct: 16  WFELKSQVHQKLVNSLTPDQLKNLSKDSVRGQVGSVVEKLIIDENLPMTMGERERLIEEI 75

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL+ L+    I+DIMVNG + V++E  G+ VET I F+D+  +  + +RIV+
Sbjct: 76  LDEVFGLGPLEGLLKDPSISDIMVNGFDNVYVERAGRVVETNIRFKDHAHVRMIIERIVS 135

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
            +GRR+D+SSPI DARL DGSRV  +IPPL+L GP ++IR++ K  LT + L+     T 
Sbjct: 136 AIGRRIDDSSPIVDARLADGSRVCAVIPPLSLIGPVMSIRRYGKRVLTTEDLLKNETFTT 195

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
                +      R N++ISGG+GSGKTT+LN L+R+I ++ERIVT EDTAEL LQQ HVV
Sbjct: 196 GMLDFMSGCVEARLNIVISGGSGSGKTTMLNTLSRFIPEEERIVTIEDTAELNLQQNHVV 255

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLETRP NIEG G I+ RDL+ N LRMRP+RII+GE RGPE LD+LQAMNTGHDGSM T+
Sbjct: 256 RLETRPANIEGAGAISQRDLLINTLRMRPDRIIVGESRGPEALDMLQAMNTGHDGSMTTV 315

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  R++F R+E M+ M    +P +++R+ + S++ +++Q  RL DG+R++  I E+ G
Sbjct: 316 HANTTRDAFSRLETMVMMASQHVPDKVIRQQLASAIHIVMQCSRLADGTRKVIGISEVAG 375

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +E + +  QD+ +++  G    GK++G+    G ++P    R   YG
Sbjct: 376 VENDQVEMQDIFEFDRTGISPRGKVVGKFHGCG-NKPICLERLKAYG 421


>gi|317123665|ref|YP_004097777.1| type II secretion system protein E [Intrasporangium calvum DSM
           43043]
 gi|315587753|gb|ADU47050.1| type II secretion system protein E [Intrasporangium calvum DSM
           43043]
          Length = 462

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 267/391 (68%), Gaps = 6/391 (1%)

Query: 81  YDSQSARDEIAT----LMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDI 136
           YD   +  E+A+     + +++  ++  +SL ++  + +D+ +DILG+GPL+P +   D+
Sbjct: 62  YDPHLSEAELASQVRVTLQDVIDSEQTPLSLADRTRIAQDVSDDILGHGPLEPFLRDQDV 121

Query: 137 ADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLD 196
            +IMVNG + +FIE  GK       F D+  L     +IV++VGRRVDESSP+ DARL D
Sbjct: 122 TEIMVNGPDDIFIEREGKIFPVDARFSDDAHLRRTIDKIVSRVGRRVDESSPMVDARLPD 181

Query: 197 GSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLIS 256
           GSRVN ++PP+ALDG  LTIRKF  D  T   L+SFG ++      L+   R R N++IS
Sbjct: 182 GSRVNAVLPPIALDGSILTIRKFAADPFTDRDLISFGTMSPPVRDFLEACVRGRRNIVIS 241

Query: 257 GGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRD 316
           GGTGSGKTT LN L+ ++  DERI+T ED AELQL Q HV+RLE+RPPNIEG G I +R+
Sbjct: 242 GGTGSGKTTTLNVLSSFLPDDERIITIEDAAELQLHQDHVLRLESRPPNIEGRGAIAIRE 301

Query: 317 LVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMG 376
           LV+N LRMRP+RII+GEVR    LD+LQAMNTGHDGS+ T+HAN+ R+S  R+E M+ M 
Sbjct: 302 LVRNSLRMRPDRIIVGEVRDGAALDMLQAMNTGHDGSLTTVHANSPRDSLSRLETMVLMA 361

Query: 377 GFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MG 435
           G  LP + +RE + S++D+IVQ  RL+DGSRRI  I E+VGME +++  QD+  ++   G
Sbjct: 362 GVELPVRAIREQVASAIDLIVQQSRLKDGSRRIVAITEVVGMESDIVTLQDIYTFDYSAG 421

Query: 436 EDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
            DE+G+  GQ + TG+ RP+F    A  G E
Sbjct: 422 RDESGRYRGQLVPTGI-RPKFTTDLADVGVE 451


>gi|317491686|ref|ZP_07950121.1| type II/IV secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920120|gb|EFV41444.1| type II/IV secretion system protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 426

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 254/364 (69%), Gaps = 1/364 (0%)

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           E+  ++  +   + I +S   Q    E + ++ILGYGPL+PL+  + ++DI+VNG   ++
Sbjct: 37  EMNRVLEGVAEQQNIYLSSQTQNAFAEMMADEILGYGPLRPLLEDETVSDILVNGPKSIY 96

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E  GK   T   F +N QL  + +R+V +VGRR+DE  P+ DARL DGSR+NV IPP+A
Sbjct: 97  VERFGKLELTTCRFINNNQLTDIAKRLVQKVGRRLDEGRPLVDARLHDGSRLNVAIPPIA 156

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           LDG +++IRKF K  + L  L+  GA++ + A  L I  R R N++ISGGTGSGKTTLLN
Sbjct: 157 LDGTSISIRKFGKSNIELSDLIRMGAMSGQMANFLIIAARCRVNIIISGGTGSGKTTLLN 216

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L++YID  ERI+T ED AEL++ QPHV+R+ETR   +E  G+ITMR L+ N LRMRP+R
Sbjct: 217 ALSKYIDPSERIITMEDAAELRMMQPHVLRMETRLAGVENTGQITMRALLINSLRMRPDR 276

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           II+GE RG E  ++LQAMNTGHDGSM T+HANN R++  R+E M+ M G  +P + +R  
Sbjct: 277 IIVGECRGEESFEMLQAMNTGHDGSMSTLHANNPRDAISRLENMVMMAGMNIPMESIRRN 336

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGE-DETGKLIGQHI 447
           I S++++I+Q  RL DGSR+I NI E++G+EG+ +I QD+  ++   E DE GK+ G+ +
Sbjct: 337 IVSAINIIIQVSRLNDGSRKIMNISEVMGIEGDRVILQDIFTFQSQSERDENGKIKGEFV 396

Query: 448 STGV 451
           + G+
Sbjct: 397 NHGL 400


>gi|313902404|ref|ZP_07835807.1| type II secretion system protein E [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467335|gb|EFR62846.1| type II secretion system protein E [Thermaerobacter subterraneus
           DSM 13965]
          Length = 458

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/411 (48%), Positives = 283/411 (68%), Gaps = 5/411 (1%)

Query: 56  PHYYEVKSTIFTTLIEMIDITQLSQYD--SQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           PH   +K+ I   LI+ +D   L + +  S+  R  I   + E ++ ++ ++S  E+  L
Sbjct: 42  PHRA-LKNRIQLRLIDEVDARALVRPEGPSEEQRAAIRAKILEYLAEEE-SVSPLERESL 99

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            E L  +ILG+GPL+ L+   +I++IM+N  ++V++E  G+     + F D+ Q+L + +
Sbjct: 100 AETLMAEILGFGPLEALLQDPEISEIMINARDQVYVERRGRLERAPVQFEDDRQILHLIE 159

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +IV  +GRR+DE+SP+ DARL DGSRVN IIPPLAL GP LTIRKF +D L +D L+ FG
Sbjct: 160 KIVAPLGRRIDEASPMVDARLPDGSRVNAIIPPLALRGPCLTIRKFSRDPLQVDDLIRFG 219

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
            ++   A  L+   R R N+++SGGTGSGKTT LN L+ +I  DERI+T ED AELQL+Q
Sbjct: 220 TLSPRMAVFLEAAVRGRLNIIVSGGTGSGKTTTLNVLSSFIPPDERIITIEDAAELQLRQ 279

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
            HVV LETRPPNIEG GE+T+R LV+N LRMRP+RI++GEVR  E LD+LQAMNTGHDGS
Sbjct: 280 EHVVSLETRPPNIEGRGEVTIRQLVRNSLRMRPDRIVVGEVRSGEALDMLQAMNTGHDGS 339

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           + T HAN+ R+   R+E M+ M G  LP + +RE I S++D+IV   R +DG+R+IT+I 
Sbjct: 340 LTTAHANSPRDLLSRLETMVLMAGIDLPVRAIREQIASAIDLIVHQSRFKDGTRKITHIT 399

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           E+ GMEG+VI+ QDL  ++  G D  G+++G+ ++TG+ RPR   R    G
Sbjct: 400 EVQGMEGDVIVLQDLFLFQAYGVDTNGRVMGEFVATGI-RPRCQERLEAAG 449


>gi|260463897|ref|ZP_05812093.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
 gi|259030272|gb|EEW31552.1| type II secretion system protein E [Mesorhizobium opportunistum
           WSM2075]
          Length = 473

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/441 (44%), Positives = 282/441 (63%), Gaps = 9/441 (2%)

Query: 17  DNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDIT 76
           ++ P+    VV  ++  ++ L +   +A  +  N V       + +  I   L+E I++ 
Sbjct: 20  ESAPVAHHAVVIPTS--RKALPAKPETAPAKNANKV------LDARVRIHRMLLEEINLV 71

Query: 77  QLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDI 136
            L +   +  R ++   ++E    +++ ++  E   L +D+ ++++G GPL+PL+   DI
Sbjct: 72  ALERLPREEMRRQVHDFVSEKTRQERMAINTAELDALVDDIVDEMVGLGPLEPLLKDPDI 131

Query: 137 ADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLD 196
            DI++NG    F+E  GK  +  I F+D   LL +  +IV  VGRRVDES P+ DAR+LD
Sbjct: 132 NDILINGHQNCFVEKKGKLQQVHIPFKDEAHLLRIINKIVAAVGRRVDESQPMVDARMLD 191

Query: 197 GSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLIS 256
           GSR N  I P+ +DGP ++IRKF K+KL L  LV FGA+T   A +L      R   +IS
Sbjct: 192 GSRFNAAIRPVGVDGPLVSIRKFSKNKLGLHKLVEFGAITQNMAEVLAAAVHARKTTIIS 251

Query: 257 GGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRD 316
           GGTG+GKTT+LN L+ +I +DER++T ED AELQLQQPHV R+ETRP NIEG GE+  RD
Sbjct: 252 GGTGTGKTTMLNALSAFIPEDERLITIEDAAELQLQQPHVARMETRPANIEGHGELKQRD 311

Query: 317 LVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMG 376
           LVKN LRMRP+R+ILGE RG E  D+LQAMNTGH+GSM TIHAN  R++  R+E M+ M 
Sbjct: 312 LVKNALRMRPDRVILGECRGEEAFDMLQAMNTGHEGSMATIHANTPRDAISRLEQMLGMT 371

Query: 377 GFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGE 436
           G  +  Q +R  I S++D+IVQ  RL DG R++T++ E+ GMEG+VI  Q++ ++   G 
Sbjct: 372 GMPMTVQSIRSQIASAIDLIVQLTRLSDGKRKVTSVAEVTGMEGDVIQMQEIFRFVRTGM 431

Query: 437 DETGKLIGQHISTGVSRPRFW 457
           D  G ++G   +TG+ RPRF 
Sbjct: 432 DADGSILGYFEATGI-RPRFL 451


>gi|46143339|ref|ZP_00204446.1| COG4962: Flp pilus assembly protein, ATPase CpaF [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208034|ref|YP_001053259.1| tight adherence protein A [Actinobacillus pleuropneumoniae L20]
 gi|190149862|ref|YP_001968387.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251575|ref|ZP_07337749.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252184|ref|ZP_07338352.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245409|ref|ZP_07527497.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247524|ref|ZP_07529569.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307249756|ref|ZP_07531734.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252112|ref|ZP_07534011.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307254364|ref|ZP_07536202.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256571|ref|ZP_07538352.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307258822|ref|ZP_07540554.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261002|ref|ZP_07542684.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263186|ref|ZP_07544807.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|126096826|gb|ABN73654.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|189914993|gb|ACE61245.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302648967|gb|EFL79155.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302649573|gb|EFL79755.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853750|gb|EFM85967.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306856027|gb|EFM88185.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306858171|gb|EFM90249.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860412|gb|EFM92426.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306862663|gb|EFM94619.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306864981|gb|EFM96883.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306867173|gb|EFM99029.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306869304|gb|EFN01099.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871548|gb|EFN03271.1| Type II secretion protein [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 425

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 282/417 (67%), Gaps = 8/417 (1%)

Query: 67  TTLIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGY 124
           T L+  +D+ +L +  ++  +  DE+   +  I ++  I ++  +   +   + ++I GY
Sbjct: 12  TELLSNLDVEKLDEIQNERNKLIDELTQSLYRISNLHSIYLTPADAAYMAGLVADEIGGY 71

Query: 125 GPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVD 184
           GP++ L+  + + DI+VNG + +++E  G   +T   F +NEQL  + +R+V +VGRR+D
Sbjct: 72  GPIRELMEDEGVNDILVNGPDNIWVERAGILEKTDKKFINNEQLTDIAKRLVARVGRRID 131

Query: 185 ESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQ 244
           E  P+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV++G++T + A  L 
Sbjct: 132 EGMPLVDSRLPDGSRLNVVIQPIALDGTSISIRKFSKSKKSLQDLVNYGSMTLDMANFLI 191

Query: 245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPP 304
           I  R R N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR  
Sbjct: 192 IAARSRVNIIVSGGTGSGKTTLLNALSHYISHTERVLTLEDTAELRLEQPHVVRLETRLA 251

Query: 305 NIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARE 364
            +E  GEI+M+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R+
Sbjct: 252 GVERTGEISMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANSPRD 311

Query: 365 SFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVII 424
           +  R+E+M+ M   +LP + +R  I S++++I+Q  RL DGSR++TNI E++GME   I+
Sbjct: 312 ALARLESMVMMSNASLPLEAIRRNIASAVNIIIQASRLNDGSRKVTNITEVMGMENGQIV 371

Query: 425 TQDLLKYE-VMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSLEKQ 479
            QD+  YE     DE  K+IGQ  + G ++R   +  A  +    NL++ LQ++ K+
Sbjct: 372 LQDIFSYEPSKYRDEDNKIIGQFTNHGLLTRSVVYQNAQMF----NLSDELQNIFKE 424


>gi|171921004|gb|ACB59187.1| TadA [Actinobacillus suis ATCC 33415]
          Length = 425

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 282/417 (67%), Gaps = 8/417 (1%)

Query: 67  TTLIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGY 124
           T L+  +D+ +L +  ++  +  +E+   +  I S   I ++  +   +   + ++I GY
Sbjct: 12  TELLSNLDVEKLDEIQNERNKLIEELTQSLYRIASSNAIYLTPADATYMAGLVADEIDGY 71

Query: 125 GPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVD 184
           GP++ L+  + + DI+VNG + ++IE  G   +T   F +NEQL  + +R+V +VGRR+D
Sbjct: 72  GPIRELMEDETVNDILVNGPDNIWIERAGILEKTNRTFINNEQLTDIAKRLVARVGRRID 131

Query: 185 ESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQ 244
           E  P+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV+FG++T + A  L 
Sbjct: 132 EGMPLVDSRLPDGSRLNVVIQPIALDGTSISIRKFSKSKKSLQDLVNFGSMTLDMANFLI 191

Query: 245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPP 304
           I  R R N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR  
Sbjct: 192 IAARSRVNIIVSGGTGSGKTTLLNALSNYISPTERVLTLEDTAELRLEQPHVVRLETRLA 251

Query: 305 NIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARE 364
            +E  GEI+M+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R+
Sbjct: 252 GVEKTGEISMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANSPRD 311

Query: 365 SFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVII 424
           +  R+E+M+ M   +LP + +R  I+S++++I+Q  RL DGSR++TNI EI+GME   I+
Sbjct: 312 ATARLESMVMMSNASLPLEAIRRNISSAVNIIIQASRLNDGSRKVTNITEILGMENGQIV 371

Query: 425 TQDLLKYE-VMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSLEKQ 479
            QD+  +E     DE  K+IG+ I+ G ++R   +  A  +    NL+  LQ++ K+
Sbjct: 372 LQDIFSFEPSKYRDENNKIIGKFINHGLLTRSVVYQNAQMF----NLSNELQNIFKE 424


>gi|33152383|ref|NP_873736.1| tight adherence protein A [Haemophilus ducreyi 35000HP]
 gi|21326710|gb|AAL92470.1| TadA [Haemophilus ducreyi]
 gi|33148606|gb|AAP96125.1| tight adherence protein A [Haemophilus ducreyi 35000HP]
          Length = 427

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/408 (45%), Positives = 276/408 (67%), Gaps = 7/408 (1%)

Query: 69  LIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGP 126
           L+  +++  L + +++ ++   E+   +  + +   I ++  +  D+ E + ++I GYGP
Sbjct: 14  LLSNLNVDTLDEIENERSKLVTELTQSLYRVANTNNIYITPYDATDMAEIVADEIGGYGP 73

Query: 127 LQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDES 186
           ++ L+  D + DI+VNG + ++IE  G   +T   F +NEQL  + +R+V +VGRR+DE 
Sbjct: 74  IRELMEDDTVNDILVNGPDNIWIERAGVLEKTNKTFINNEQLTDIAKRLVARVGRRIDEG 133

Query: 187 SPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQII 246
            P+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV+FG++T + A  L I 
Sbjct: 134 MPLVDSRLPDGSRLNVVIQPIALDGTSISIRKFSKSKKSLQELVNFGSMTLDMANFLIIA 193

Query: 247 GRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNI 306
            R R N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR   +
Sbjct: 194 ARSRVNIIVSGGTGSGKTTLLNALSSYISPTERVLTLEDTAELRLEQPHVVRLETRLAGV 253

Query: 307 EGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESF 366
           E  GEITM+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN  R++ 
Sbjct: 254 ERTGEITMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANTPRDAT 313

Query: 367 GRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQ 426
            R+E+M+ M   +LP + +R  I S++++I+Q  RL DGSR++ NI E++GME   I+ Q
Sbjct: 314 ARLESMVMMSNASLPLEAIRRNIASAVNIIIQASRLNDGSRKVMNITEVMGMENGQIVLQ 373

Query: 427 DLLKYEV-MGEDETGKLIGQHISTG-VSRPRFWNRAAQY---GEEKNL 469
           D+  +E     DE  K+IG+ ++ G ++R   +  A  +   GE +N+
Sbjct: 374 DIFSFEASQHRDENNKIIGKFVNHGLLTRSAVYQNAQVFNLTGELQNI 421


>gi|187921507|ref|YP_001890539.1| FHA domain-containing protein [Burkholderia phytofirmans PsJN]
 gi|187719945|gb|ACD21168.1| FHA domain containing protein [Burkholderia phytofirmans PsJN]
          Length = 634

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 266/406 (65%), Gaps = 4/406 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           +P   E++      +I  +D+ +L  ++ +    R  ++  +++I++      S D  L+
Sbjct: 210 SPVGIELRKQAHMKVIAALDLRRLNVARMEEDDLRKTVSAALDDILNHDASFRSPDIALE 269

Query: 113 -LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            L + + ++I+G GPL+ L+A   +++IMVN  +++F+E  G+   T + F D+  ++  
Sbjct: 270 TLKKSVFDEIIGLGPLEELLADPTVSEIMVNCHDEIFVEQAGQLKRTPVIFTDDRAVIGA 329

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++TIRKF K KL    L++
Sbjct: 330 IERIVAPIGRRIDESSPMVDARLADGSRVNAVIPPLALKGPSITIRKFSKRKLVGQDLLN 389

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG ++ E    L        N++ISGGTGSGKTTLLN L+ YI   ERIVT ED AELQL
Sbjct: 390 FGTMSPEMLEFLHTAVEQGANIIISGGTGSGKTTLLNVLSSYIPDSERIVTVEDAAELQL 449

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QP++V LE RP N+EG+G I +RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTGHD
Sbjct: 450 SQPNLVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHD 509

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ T HAN  R+   R+E M  M G  LP Q +RE I S++D+IVQ  R   GSRR+T+
Sbjct: 510 GSLTTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDIIVQQSRFSCGSRRVTH 569

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           + E+ GME  VI  QD+  ++  G  E GK++G+ + T    P F+
Sbjct: 570 VTEVSGMESGVITLQDVFVFKEEGFGENGKIVGKFVPTAYI-PDFY 614


>gi|170724973|ref|YP_001758999.1| type II secretion system protein E [Shewanella woodyi ATCC 51908]
 gi|169810320|gb|ACA84904.1| type II secretion system protein E [Shewanella woodyi ATCC 51908]
          Length = 423

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/337 (52%), Positives = 240/337 (71%), Gaps = 1/337 (0%)

Query: 134 DDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDAR 193
           D I DIMVNG +++F E +GK   + + F +  QLL + QRI  +VGRRVDESSP+ DAR
Sbjct: 79  DSINDIMVNGPDQIFYERHGKIHSSEVVFVNEAQLLEIAQRIAARVGRRVDESSPMVDAR 138

Query: 194 LLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNV 253
           L +GSRVN++I P+A+DG T++IRKF++ K+ L+ LV FG+++ E AR+L I  R R N+
Sbjct: 139 LSNGSRVNIVIKPIAIDGTTISIRKFREQKIGLEELVGFGSLSPEMARVLMIAARCRLNI 198

Query: 254 LISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEIT 313
           LISGGTGSGKTTLLN L+ YI  DERI+T ED AEL LQQPHVVRLETRP +IE  G++ 
Sbjct: 199 LISGGTGSGKTTLLNALSNYIADDERIITIEDAAELNLQQPHVVRLETRPASIENSGQVD 258

Query: 314 MRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMI 373
            RDL+ N LRMRP+RIILGE RG E  ++LQAMNTGHDGSM T+HAN  R++  R+E+M+
Sbjct: 259 QRDLIINSLRMRPDRIILGECRGAEAFEMLQAMNTGHDGSMSTLHANTPRDAISRVESMV 318

Query: 374 AMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV 433
            M     P   +R  I  ++ ++VQ  R RDGSR+IT+I E+VG+EG  ++ ++L K++ 
Sbjct: 319 MMASLNQPLDAIRRTIVGAVHLVVQVNRQRDGSRKITSISEVVGLEGENVVMEELFKFQP 378

Query: 434 MGEDETGKLIGQHISTGV-SRPRFWNRAAQYGEEKNL 469
                  K++G+++S G+  R     RAA +G +  L
Sbjct: 379 TEGQSMEKVLGEYLSPGIMQRSVLMQRAAYFGLQDEL 415


>gi|315181054|gb|ADT87968.1| Flp pilus assembly protein [Vibrio furnissii NCTC 11218]
          Length = 486

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 250/333 (75%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    ++DI+VNG   VF+E  GK   T   F D+  L ++  RIV+Q
Sbjct: 129 DEVFGLGPLEPLLHDSTVSDILVNGPKSVFVERRGKLERTPYTFLDDRHLRNIIDRIVSQ 188

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSRVN IIPPLALDGP+++IR+F  DKLT+D+L+SF +++ +
Sbjct: 189 VGRRIDEASPMVDARLADGSRVNAIIPPLALDGPSVSIRRFAVDKLTMDNLLSFNSLSEQ 248

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   +   N+LISGGTGSGKTT LN  + +I K++RI+T ED+AELQLQQPHVVR
Sbjct: 249 MAKFVEAAVKGELNILISGGTGSGKTTTLNIFSGFIPKEDRIITIEDSAELQLQQPHVVR 308

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 309 LETRPANLEGKGEITQRDLVKNSLRMRPDRIVLGEVRGSEAVDMLAAMNTGHDGSLATIH 368

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ ++ EI GM
Sbjct: 369 ANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSVSEINGM 428

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG++I   ++ K++  G D+ G ++G + +TGV
Sbjct: 429 EGDIITMSEIFKFQRQGMDDEGNVVGHYTATGV 461


>gi|13471029|ref|NP_102598.1| secretory protein [Mesorhizobium loti MAFF303099]
 gi|14021773|dbj|BAB48384.1| probable secretory protein [Mesorhizobium loti MAFF303099]
          Length = 473

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/398 (47%), Positives = 264/398 (66%), Gaps = 1/398 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           + +  I   L+E I++  L +      R ++   ++E    +++ ++  E   L +D+ +
Sbjct: 55  DARVRIHRMLLEEINLVALERLPKDEMRRQVHDFVSEKTRQERMAINTAELEALVDDIVD 114

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           +++G GPL+PL+   +I DI++NG    FIE  GK  +  I F+D   LL +  +IV  V
Sbjct: 115 EMVGLGPLEPLLKDPEINDILINGHQNCFIEKKGKLQQVHIPFKDEAHLLRIINKIVAAV 174

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDES P+ DAR+LDGSR N  I P+ +DGP ++IRKF K+KL L  LV FGA+T   
Sbjct: 175 GRRVDESQPMVDARMLDGSRFNAAIRPVGVDGPLVSIRKFSKNKLGLHKLVEFGAITQNM 234

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A +L      R   +ISGGTG+GKTT+LN L+ +I +DER++T ED AELQLQQPHV R+
Sbjct: 235 AEVLAAAVHARKTTIISGGTGTGKTTMLNALSAFIPEDERLITIEDAAELQLQQPHVARM 294

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP NIEG GE+  RDLVKN LRMRP+R+ILGE RG E  D+LQAMNTGH+GSM TIHA
Sbjct: 295 ETRPANIEGHGELKQRDLVKNALRMRPDRVILGECRGEEAFDMLQAMNTGHEGSMATIHA 354

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R++  R+E M+ M G  +  Q +R  I S++D+IVQ  RL DG R++T++ E+ GME
Sbjct: 355 NTPRDAISRLEQMLGMTGMPMTVQSIRSQIASAIDIIVQLTRLSDGKRKVTSVAEVTGME 414

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           G+VI  Q++ ++   G D  G ++G   +TG+ RPRF 
Sbjct: 415 GDVIQMQEIFRFVRTGMDADGGILGYFEATGI-RPRFL 451


>gi|260771472|ref|ZP_05880397.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio furnissii CIP 102972]
 gi|260613598|gb|EEX38792.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio furnissii CIP 102972]
          Length = 486

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 291/443 (65%), Gaps = 12/443 (2%)

Query: 9   LMGSVKREDNNPLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTT 68
           L+ S  ++D +PL  E  +  S+ + + +  +    E E+        HYY  +      
Sbjct: 31  LLASGPKQDESPL--ERKLRESDAKNREIDDARKQLEQELA-----VKHYYHQRLLETLD 83

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           L  +  + +      +   D I  LM      +   +S + +  + + + +++ G GPL+
Sbjct: 84  LALLSSLEK--DRAKKDLHDAIVQLM---ADDQTHALSAEGRKRVIKQIEDEVFGLGPLE 138

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSP 188
           PL+    ++DI+VNG   VF+E  GK   T   F D+  L ++  RIV+QVGRR+DE+SP
Sbjct: 139 PLLHDSTVSDILVNGPKSVFVERRGKLERTPYTFLDDRHLRNIIDRIVSQVGRRIDEASP 198

Query: 189 ICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR 248
           + DARL DGSRVN IIPPLALDGP+++IR+F  DKLT+D+L+SF +++ + A+ ++   +
Sbjct: 199 MVDARLADGSRVNAIIPPLALDGPSVSIRRFAVDKLTMDNLLSFNSLSEQMAKFVEAAVK 258

Query: 249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEG 308
              N+LISGGTGSGKTT LN  + +I K++RI+T ED+AELQLQQPHVVRLETRP N+EG
Sbjct: 259 GELNILISGGTGSGKTTTLNIFSGFIPKEDRIITIEDSAELQLQQPHVVRLETRPANLEG 318

Query: 309 EGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGR 368
           +GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDGS+ TIHAN  R++  R
Sbjct: 319 KGEITQRDLVKNSLRMRPDRIVLGEVRGSEAVDMLAAMNTGHDGSLATIHANTPRDALSR 378

Query: 369 MEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL 428
           +E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ ++ EI GMEG++I   ++
Sbjct: 379 VENMFAMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSVSEINGMEGDIITMSEI 438

Query: 429 LKYEVMGEDETGKLIGQHISTGV 451
            K++  G D+ G ++G + +TGV
Sbjct: 439 FKFQRQGMDDEGNVVGHYTATGV 461


>gi|296122066|ref|YP_003629844.1| type II secretion system protein E [Planctomyces limnophilus DSM
           3776]
 gi|296014406|gb|ADG67645.1| type II secretion system protein E [Planctomyces limnophilus DSM
           3776]
          Length = 449

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/432 (43%), Positives = 272/432 (62%), Gaps = 9/432 (2%)

Query: 36  NLQSSSPSAEGEIGNFVNRTPHYYEV-KSTIFTTLIEMIDITQLSQYDSQSARDEIATLM 94
           +LQ+SS       GN +      +E+ K+ I   +I+ ID+++ S       R ++  L 
Sbjct: 4   DLQNSS-------GNRMQDRRQEFEILKTRIHRQMIDAIDLSKASDLPEADLRAQLRALA 56

Query: 95  NEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGK 154
           N +   ++  +  D++  +   + ++I G+GP++PL++  D+ D+++NG++ VF+E NG 
Sbjct: 57  NHLCQQQQANIPADDREIMVTAIMDEIYGFGPIEPLMSDTDVTDVLINGADTVFVERNGL 116

Query: 155 TVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTL 214
              T I F DNE L+    R+V + GRR+DE SP+ DA+L DGSR+N +IPPLAL GPT+
Sbjct: 117 IERTDIQFADNEHLMQFIHRMVGRTGRRIDEVSPMVDAKLPDGSRLNAVIPPLALRGPTV 176

Query: 215 TIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYI 274
           +IR+F+   +  + +V    +T E A  L    R R N+++SGGTG+GKTT+LN ++R+I
Sbjct: 177 SIRRFRSRAVVFEDMVRMHTLTQEMADFLIAAVRGRLNIVVSGGTGAGKTTMLNNISRFI 236

Query: 275 DKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEV 334
            + ER+VT E TAELQLQQ  VV LETRPPNIEG GEIT RDL+KN LRMRP+RII+GE 
Sbjct: 237 PETERVVTIEQTAELQLQQKDVVSLETRPPNIEGRGEITQRDLLKNSLRMRPDRIIVGEA 296

Query: 335 RGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLD 394
           RG EVLD+LQAMNTGHDGSM TIHAN+ R++  RME M+A+ G  LP  + R+ I +++ 
Sbjct: 297 RGGEVLDMLQAMNTGHDGSMSTIHANDTRDALDRMELMVALAGVDLPHSVARQYIANAIQ 356

Query: 395 VIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRP 454
           ++V   RL  G R++  I E+ G    +    D+  Y + G    G+  G   +TG   P
Sbjct: 357 ILVHITRLGTGERKVMRISELTGYHDGIYELNDIYVYRMTGIGSDGRARGAFYATG-HEP 415

Query: 455 RFWNRAAQYGEE 466
               + A  G E
Sbjct: 416 EMLKKLAARGYE 427


>gi|220922534|ref|YP_002497836.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
 gi|219947141|gb|ACL57533.1| type II secretion system protein E [Methylobacterium nodulans ORS
           2060]
          Length = 463

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 182/419 (43%), Positives = 272/419 (64%), Gaps = 6/419 (1%)

Query: 42  PSAEGEIGNF----VNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           PS   EI +     V+R P   + K  +   +I+  ++  L +  +      +   ++E 
Sbjct: 25  PSRSEEIASVAVPKVSR-PALIDEKVKLHAKIIDEFNLALLDKIPADELNRHVRNFVSEY 83

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           V  ++I ++  E     +++ ++++G GP++PL+    I+DI++N    V++E  G+   
Sbjct: 84  VKTERIPLNQTEFETFADEVFDEMVGLGPIEPLLKDPTISDILINSHESVYVERGGQLEP 143

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           T + F+D   LL +  +IV +VGRRVDESSP+ DARL DGSRVN  I P+A+DGP ++IR
Sbjct: 144 TTVRFKDEAHLLRIVTKIVAKVGRRVDESSPMVDARLPDGSRVNAAIRPVAVDGPQVSIR 203

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KF K   ++D L+  GA+    A +L+     R ++++SGGTGSGKTT+LN L+ +I   
Sbjct: 204 KFSKRPFSMDRLIEVGALRPSIAEVLKAAVHGRVSMIVSGGTGSGKTTMLNVLSTFISPK 263

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           ER++T ED AELQLQQ HV RLETRPPN EG+GEI  R+LVKN LRMRP+RII+GEVRG 
Sbjct: 264 ERLITIEDAAELQLQQHHVSRLETRPPNAEGKGEIRQRELVKNALRMRPDRIIIGEVRGE 323

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           E  D+LQAMNTGH+GSM TIHAN  R++  R+E M+ M G  +    +R  I S++ V++
Sbjct: 324 EAFDMLQAMNTGHEGSMTTIHANTPRDAIRRLEQMVGMSGLPMSLNSIRTQIASAIQVVI 383

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRF 456
           Q QRL DG+RR+ ++ E+ GMEG+V+  Q++ ++   G D  G ++G   +TG+ RP+F
Sbjct: 384 QLQRLSDGTRRMVSLSEVTGMEGDVVQMQEIFRFAREGVDSNGTVLGSFRATGI-RPKF 441


>gi|165975971|ref|YP_001651564.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|165876072|gb|ABY69120.1| tight adherence protein A [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 425

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 187/417 (44%), Positives = 281/417 (67%), Gaps = 8/417 (1%)

Query: 67  TTLIEMIDITQLSQYDSQSAR--DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGY 124
           T L+  +D+ +L +  ++  +  DE+   +  I ++  I ++  +   +   + ++I GY
Sbjct: 12  TELLSNLDVEKLDEIQNERNKLIDELTQSLYRISNLHSIYLTPADAAYMAGLVADEIGGY 71

Query: 125 GPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVD 184
           GP++ L+  + + DI+VNG + +++E  G   +T   F +NEQL  + +R+V +VGRR+D
Sbjct: 72  GPIRELMEDEGVNDILVNGPDNIWVERAGILEKTDKKFINNEQLTDIAKRLVARVGRRID 131

Query: 185 ESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQ 244
           E  P+ D+RL DGSR+NV+I P+ALDG +++IRKF K K +L  LV++G++T + A  L 
Sbjct: 132 EGMPLVDSRLPDGSRLNVVIQPIALDGTSISIRKFSKSKKSLQDLVNYGSMTLDMANFLI 191

Query: 245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPP 304
           I  R R N+++SGGTGSGKTTLLN L+ YI   ER++T EDTAEL+L+QPHVVRLETR  
Sbjct: 192 IAARSRVNIIVSGGTGSGKTTLLNALSHYISHTERVLTLEDTAELRLEQPHVVRLETRLA 251

Query: 305 NIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARE 364
            +E  GEI+M+DLV N LRMRPERII+GE RG E   +LQAMNTGHDGSM T+HAN+ R+
Sbjct: 252 GVERTGEISMQDLVINALRMRPERIIVGECRGAEAFQMLQAMNTGHDGSMSTLHANSPRD 311

Query: 365 SFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVII 424
           +  R+E+M+ M   +LP + +R  I S++++I+Q  RL DGSR++TNI E++GME   I+
Sbjct: 312 ALARLESMVMMSNASLPLEAIRRNIASAVNIIIQASRLNDGSRKVTNITEVMGMENGQIV 371

Query: 425 TQDLLKYE-VMGEDETGKLIGQHISTG-VSRPRFWNRAAQYGEEKNLAEVLQSLEKQ 479
            QD+  YE     DE  K+IGQ  + G ++R      A  +    NL++ LQ++ K+
Sbjct: 372 LQDIFSYEPSKYRDEDNKIIGQFTNHGLLTRSVVCQNAQMF----NLSDELQNIFKE 424


>gi|238796994|ref|ZP_04640498.1| Type II secretion protein [Yersinia mollaretii ATCC 43969]
 gi|238719254|gb|EEQ11066.1| Type II secretion protein [Yersinia mollaretii ATCC 43969]
          Length = 428

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 259/384 (67%), Gaps = 2/384 (0%)

Query: 97  IVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTV 156
           + S  K  ++  EQ    E + ++I G+GPL+ L+  + I+DIMVNG  K+FIE  G   
Sbjct: 45  LFSDNKYKLTTQEQEKSIEMISDEITGFGPLRELMEDESISDIMVNGPEKIFIERYGLIT 104

Query: 157 ETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTI 216
            T   F +N QL  + +R++ +V RR+DE  P+ DARL+DGSR+N  I P+ LDG +L+I
Sbjct: 105 LTNRRFINNTQLTDITKRLMQRVNRRIDEGRPLADARLIDGSRINAAISPITLDGTSLSI 164

Query: 217 RKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDK 276
           RKF K+K  L+ LV  GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI +
Sbjct: 165 RKFSKNKRKLEDLVDMGAMSSDMANFLIISASCRVNIIISGGTGSGKTTLLNALSKYISE 224

Query: 277 DERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRG 336
           +ER++T ED AEL L+QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG
Sbjct: 225 NERVITLEDAAELNLEQPHVVRMETRLAGVENTGQITMRDLVINSLRMRPDRIIIGECRG 284

Query: 337 PEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVI 396
            E  ++LQAMNTGH+GSM T+HAN  R++  R+E+MI MG   +P   +R  I S++++I
Sbjct: 285 EETFEMLQAMNTGHNGSMSTLHANTPRDAIARLESMIMMGPVNMPIFTIRRNIASAINLI 344

Query: 397 VQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGE-DETGKLIGQHISTG-VSRP 454
           VQ  R+ DGSR+I NI EI+GMEG  I+ QD+  ++ + E D+ GK+ G+ I+ G +SR 
Sbjct: 345 VQVSRMNDGSRKIRNISEIMGMEGENIVLQDIFSFKPIKERDQQGKIQGEFINHGLLSRS 404

Query: 455 RFWNRAAQYGEEKNLAEVLQSLEK 478
                +  Y     L+ +   +EK
Sbjct: 405 SVRVNSEIYNLSNELSSIFSMVEK 428


>gi|37680191|ref|NP_934800.1| Flp pilus assembly protein TadA [Vibrio vulnificus YJ016]
 gi|320156056|ref|YP_004188435.1| flp pilus assembly protein TadA [Vibrio vulnificus MO6-24/O]
 gi|37198938|dbj|BAC94771.1| Flp pilus assembly protein TadA [Vibrio vulnificus YJ016]
 gi|319931368|gb|ADV86232.1| flp pilus assembly protein TadA [Vibrio vulnificus MO6-24/O]
          Length = 430

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 183/374 (48%), Positives = 258/374 (68%), Gaps = 3/374 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   T F  LIE  +  +L++   Q    EI   + ++ + + +  +  E   L E LC+
Sbjct: 21  EAAQTAFEKLIEPSEAVKLTRKQLQQ---EIQKAVAQLSAQQLLPYNQSELAILVEQLCD 77

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+LG GP+Q L+    ++DI+VNG  +++IE  GK ++T I FRD + LL+V QRIVN V
Sbjct: 78  DMLGVGPIQCLVEDPSVSDILVNGPEQIYIERQGKLLKTDIRFRDKKHLLNVAQRIVNAV 137

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DES+P+ DARL DGSRVN+I PPLAL+G  ++IRKF + +  L  LV+FG+++ E 
Sbjct: 138 GRRLDESTPLVDARLEDGSRVNIIAPPLALNGVCISIRKFPERQYDLPGLVAFGSLSEEM 197

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A+ L +  R R N+L+SGGTG+GKTTLLN ++  I  DERI+T ED AEL L QPH ++L
Sbjct: 198 AQCLALAARCRLNILVSGGTGAGKTTLLNAMSTPISDDERIITIEDAAELSLTQPHWIQL 257

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETR  + EG G +T+RDLVKN LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+HA
Sbjct: 258 ETRTASSEGTGAVTVRDLVKNALRMRPDRIILGEVRGAEAFDMLQAMNTGHDGSLCTLHA 317

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+  ++  R+E M+ MG   +PS ++R+ I+S+LD++VQ +R  DG RR+T I  + G+E
Sbjct: 318 NSPADAMLRLENMLMMGAEQIPSAVLRQQISSALDLVVQLERSHDGKRRVTAISAVGGIE 377

Query: 420 GNVIITQDLLKYEV 433
              I+   L +Y +
Sbjct: 378 QGQIVVHPLFEYRL 391


>gi|84498179|ref|ZP_00996976.1| Flp pilus assembly protein TadA [Janibacter sp. HTCC2649]
 gi|84381679|gb|EAP97562.1| Flp pilus assembly protein TadA [Janibacter sp. HTCC2649]
          Length = 454

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 196/408 (48%), Positives = 272/408 (66%), Gaps = 9/408 (2%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIAT----LMNEIVSVKKITMSLDE 109
           R   + EVK  +   LI   D      YD      E+A+     + E++  ++  +SL +
Sbjct: 30  RVDPFTEVKERVHQGLI---DSLGPRLYDPHLKESELASQVRQTLQEVIDAEQKPLSLSD 86

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           +  + +++ ++ILG+GPL+PL+   ++ +IMVNG+N +FIE  GK   T   F D   L 
Sbjct: 87  RTRIAQEVSDEILGHGPLEPLLRDPEVTEIMVNGANSIFIERAGKIYPTAARFTDETHLR 146

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
            +  RIV ++GRRVDE+SP+ DARL DGSRVNV++ P+ALDG  LTIRKF  D  T   L
Sbjct: 147 RIIDRIVGRIGRRVDEASPLVDARLPDGSRVNVVVAPIALDGAILTIRKFAADPFTDKDL 206

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           VSFG  T      L    R R N++ISGGTGSGKTT LN ++ ++  DERI+T ED AEL
Sbjct: 207 VSFGTFTPPVRDFLWACVRGRRNIIISGGTGSGKTTTLNVMSSFLPGDERIITIEDAAEL 266

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QL Q HV+R+E+RP NIEG G +T+RDLV+N LRMRP+RI++GEVR    LD+LQAMNTG
Sbjct: 267 QLHQQHVLRMESRPANIEGSGMVTIRDLVRNALRMRPDRIVVGEVRDGAALDMLQAMNTG 326

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGS+ T+HAN +R+S  R+E M+ M G  LP + +RE +  ++D+I+Q  RL+DG+RRI
Sbjct: 327 HDGSITTVHANTSRDSLSRLETMVLMSGVDLPVRAIREQVAGAIDLIIQQARLKDGTRRI 386

Query: 410 TNICEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRF 456
             I E+VGMEG++I  QDL  ++   G DE G+ +G+  STG+ RP+F
Sbjct: 387 VQITEVVGMEGDIITLQDLFAFDFAAGRDENGRFLGELRSTGI-RPKF 433


>gi|311743551|ref|ZP_07717357.1| type II/IV secretion system protein [Aeromicrobium marinum DSM
           15272]
 gi|311312681|gb|EFQ82592.1| type II/IV secretion system protein [Aeromicrobium marinum DSM
           15272]
          Length = 467

 Score =  365 bits (938), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 188/372 (50%), Positives = 266/372 (71%), Gaps = 2/372 (0%)

Query: 94  MNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNG 153
           +N+I+  +++ ++ DE+  L +D+ +D LG GPLQ ++    + ++MVNG + +++E NG
Sbjct: 81  LNQIIDDEQLLLTSDERGRLIQDIEDDALGLGPLQRVLEDPSVTEVMVNGHDCIYVERNG 140

Query: 154 KTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPT 213
           K V +G+ F     L    +RIV++VGRRVDESSP+ DARL DGSRVN ++PPLA+ G +
Sbjct: 141 KIVLSGLKFTSEAHLRRAIERIVSRVGRRVDESSPMVDARLQDGSRVNAVVPPLAVRGSS 200

Query: 214 LTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRY 273
           LTIRKF +   T   L+ FG++TA+ A LL+     R N+L+SGGTG+GKTTLLN L+ +
Sbjct: 201 LTIRKFSETPFTAKDLIEFGSMTAQMAELLRGAVEARLNILVSGGTGTGKTTLLNVLSGF 260

Query: 274 IDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGE 333
           I   ERIVT ED  EL+LQQ HVV+LE+RP NIEG GE+++RDLV+N LRMRP+RI++GE
Sbjct: 261 IPDGERIVTIEDAIELKLQQDHVVQLESRPANIEGSGEVSIRDLVRNSLRMRPDRIVVGE 320

Query: 334 VRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSL 393
            R  E LD+LQAMNTGHDGS+ T+HAN+ R+   R+E ++ M G  LP + +RE I S++
Sbjct: 321 CRSGEALDMLQAMNTGHDGSISTLHANSPRDCIARLETLVLMAGMDLPLRAIREQIASAV 380

Query: 394 DVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-MGEDETGKLIGQHISTGVS 452
           D+IVQ QRLRDG+RRIT++ E++GME +++  QD   ++   G DE G+ +G    TGV 
Sbjct: 381 DLIVQIQRLRDGTRRITHVTEVLGMEQDIVTLQDAFLFDFSAGMDEHGRFVGVQRPTGV- 439

Query: 453 RPRFWNRAAQYG 464
           RPRF  R  + G
Sbjct: 440 RPRFTERFEELG 451


>gi|113867005|ref|YP_725494.1| flp pilus assembly ATPase CpaF [Ralstonia eutropha H16]
 gi|113525781|emb|CAJ92126.1| flp pilus assembly ATPase CpaF [Ralstonia eutropha H16]
          Length = 619

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 191/419 (45%), Positives = 278/419 (66%), Gaps = 9/419 (2%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDE----IATLMNEIVSVKKITMSLDEQ 110
           +P   E++      LI  +D+ +++   ++ A DE    + +L+++I+  + +  S +  
Sbjct: 196 SPRGVELRKQAHQRLIAALDLRRVNV--ARMAEDELCELVGSLLDDILK-ESVFRSQEIP 252

Query: 111 LD-LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           LD L + + ++++G GPL+  +  D +++IMVN  +++F+E  G+   + + F D+  +L
Sbjct: 253 LDALKQSVFDEVIGPGPLEEPLDDDAVSEIMVNCHDEIFVERAGRLTRSPVIFTDDRAVL 312

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
              +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP +TIRKF + KL  + L
Sbjct: 313 GAIERIVAPLGRRIDESSPMVDARLPDGSRVNAVIPPLALKGPNITIRKFSRKKLRGEDL 372

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           V FG+++ E    L+     R N++ISGGTGSGKTTLLN L+ +I  DERIVT ED AEL
Sbjct: 373 VGFGSLSPEMLEFLRTAVERRANIVISGGTGSGKTTLLNVLSSFIPDDERIVTVEDAAEL 432

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           QL QP++V LE RPPN+EG+G +T+RDLVKNCLRMRP+RI++GE RG E LD+LQAMNTG
Sbjct: 433 QLSQPNLVSLEARPPNMEGKGAVTIRDLVKNCLRMRPDRIVVGECRGGEALDMLQAMNTG 492

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGS+ T HAN+ R+   R+E M  M G  LP Q +RE + S++DVIVQ  R   GSRR+
Sbjct: 493 HDGSLTTAHANSPRDCLSRLEVMTLMAGLDLPVQAIREQVCSAVDVIVQQTRFSCGSRRV 552

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
           T+I E+ GME  V+  QD+  +   G    GK+ G++++T    P F+    + G + N
Sbjct: 553 THITEVSGMETGVVQLQDVFMFREEGYGADGKVKGRYVATSYI-PDFYQDLIRRGIQVN 610


>gi|238790283|ref|ZP_04634057.1| Type II secretion protein [Yersinia frederiksenii ATCC 33641]
 gi|238721633|gb|EEQ13299.1| Type II secretion protein [Yersinia frederiksenii ATCC 33641]
          Length = 429

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 273/393 (69%), Gaps = 15/393 (3%)

Query: 92  TLMNEIVS-VKKITMSLDEQLD------LFEDLCNDILGYGPLQPLIARDDIADIMVNGS 144
            L+ EI++ V+KI+ + +  L       L   + ++ILG+GP++ L+  + + DI+VNG 
Sbjct: 36  ALLREIIAIVQKISQATNRYLSKEDTEKLSHAITDEILGFGPMRELLEDETVNDILVNGP 95

Query: 145 NKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVII 204
           + +F+E  GK  +T + F DN+QL  + +R+V +VGRR+DES P+ DARL DGSR+NV+I
Sbjct: 96  DNIFVERRGKLEKTKLTFLDNDQLTDIAKRLVARVGRRIDESQPLVDARLHDGSRLNVVI 155

Query: 205 PPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKT 264
            P+ALDG +++IRKF K   T   L+++G +  + A LL +  + R N++ISGGTGSGKT
Sbjct: 156 NPIALDGTSISIRKFSKISKTFKDLINYGTLDEKLANLLIMAAKCRINIIISGGTGSGKT 215

Query: 265 TLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRM 324
           TL+N L+++I  DERI+T ED AEL+L QPHVVRLET+  +IE  G++TMR+LV N LRM
Sbjct: 216 TLMNALSQHISSDERIITLEDAAELRLLQPHVVRLETKMASIENTGKVTMRNLVINALRM 275

Query: 325 RPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQM 384
           RP+RII+GE RG E  ++LQAMNTGHDGSM T+HAN  R++  R+E M+ M G +LP ++
Sbjct: 276 RPDRIIIGECRGEETFEMLQAMNTGHDGSMTTLHANTPRDAIARLENMVMMAGLSLPVEV 335

Query: 385 VREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVM-GEDETGKLI 443
           +R  I S++++I+Q  R+ DGSR+I  + E++G+EG +++ QD+ ++      D+ G ++
Sbjct: 336 IRRNIASAVNMIIQVSRMNDGSRKIMAVSEVMGIEGEMVVIQDIFRFVTENARDQQGNIV 395

Query: 444 GQHISTGVSRPRFWNRAAQYGEEK--NLAEVLQ 474
           G+ +  G+S+     R+A Y   +  NL  VL+
Sbjct: 396 GKFVCNGLSQ-----RSALYTHARLMNLEHVLK 423


>gi|261252090|ref|ZP_05944663.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
 gi|260935481|gb|EEX91470.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio orientalis CIP 102891]
          Length = 492

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 271/396 (68%), Gaps = 7/396 (1%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKI-TMSLDEQLDLFE 115
           HYY  +      L        L+  D++ A+ E+   + ++++  +   +S D +  + +
Sbjct: 78  HYYHQRLLETLDL------GLLASLDNERAKKELHDAIIQLMADDQTHALSADGRKRVIQ 131

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            + +++ G GPL+PL+    ++DI+VNG   VF+E  GK   T   F D   L ++  RI
Sbjct: 132 QIEDEVFGLGPLEPLLNDATVSDILVNGPKHVFVERRGKLELTPYTFLDERHLRNILDRI 191

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+QVGRRVDE+SP+ DARL+DGSRVN IIPPLALDG +++IR+F  +KL +D+L++F ++
Sbjct: 192 VSQVGRRVDEASPMVDARLIDGSRVNAIIPPLALDGSSVSIRRFAVEKLNMDNLLNFNSL 251

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           + E A+ ++       NVLISGGTGSGKTT LN  + +I  D+RIVT ED+AELQLQQPH
Sbjct: 252 SPEMAKFVEAAVTGAMNVLISGGTGSGKTTTLNIFSNFIPSDDRIVTIEDSAELQLQQPH 311

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRP N+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDGS+ 
Sbjct: 312 VVRLETRPANLEGKGEITQRDLVKNSLRMRPDRIVLGEVRGAEAVDMLAAMNTGHDGSLA 371

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ +ICEI
Sbjct: 372 TIHANTPRDALSRVENMFAMAGWNMSAKNLRSQIASAIHLVVQMERQEDGKRRMVSICEI 431

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
            GMEG +I   ++ K+   G DE G ++G   +TGV
Sbjct: 432 NGMEGEIITMSEIFKFHRKGMDEEGNVMGYFTATGV 467


>gi|117620753|ref|YP_855994.1| CpaF [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562160|gb|ABK39108.1| CpaF [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 437

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 254/358 (70%), Gaps = 1/358 (0%)

Query: 88  DEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           + +A+ + ++ + + +  +  E   L   L ++++G GPLQPL+   +++DI+VNG ++V
Sbjct: 46  ERVASALAQLSARRMLPYNRQELTQLARQLVDEMVGVGPLQPLLDDPEVSDILVNGPDQV 105

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           ++E +GK   +G+ FRD + + +V QRIVN VGRRVDES+P+ DARL DGSRVNVI PP+
Sbjct: 106 YVERHGKLTLSGVRFRDRQHVFNVAQRIVNAVGRRVDESTPMVDARLADGSRVNVIAPPI 165

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           AL G T++IRKF   +LTL HLV  GA++   AR L +  R R NVLISGGTGSGKTTLL
Sbjct: 166 ALCGTTISIRKFPSARLTLAHLVEKGALSDAMARFLGLAARSRFNVLISGGTGSGKTTLL 225

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           N L+++I+ DERI+T ED AEL L+QPH V LETR  + EG+GE+++R LV+N LRMRP+
Sbjct: 226 NALSKHINDDERIITIEDAAELSLEQPHWVPLETRNESAEGKGEVSVRALVRNALRMRPD 285

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RIILGEVRG E  D+LQAMNTGHDGS+ T+HAN   ++  R+  M+ MG   L  Q+++ 
Sbjct: 286 RIILGEVRGAEAFDMLQAMNTGHDGSLCTLHANTPEDALLRLTNMLQMGAERLSEQIIQA 345

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQ 445
            I S++D++VQ +R+RDG RRIT I EI  +    I  + L ++ V+  +  GKL G+
Sbjct: 346 QIASAVDLVVQLERMRDGQRRITAISEITELAEGQIRMRPLFRF-VLESELHGKLQGR 402


>gi|283787695|ref|YP_003367560.1| tight adherence protein A [Citrobacter rodentium ICC168]
 gi|282951149|emb|CBG90840.1| putative tight adherence protein A [Citrobacter rodentium ICC168]
          Length = 427

 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 271/402 (67%), Gaps = 8/402 (1%)

Query: 69  LIEMIDITQLSQYDSQSARD----EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGY 124
           +++ +DI +L+  D ++ RD    EI+  + ++V+  K  +S      L E + ++I GY
Sbjct: 16  VLKNLDIEKLN--DLRNDRDLLIKEISDNIQKVVNSSKWYLSNSASAQLTESIVDEITGY 73

Query: 125 GPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVD 184
           GPL+ L+  D I+DI+VNG + +F+E  G+       F +NEQL  + +R+V++VGRRVD
Sbjct: 74  GPLRELMDDDSISDILVNGPDHIFVERGGRLERVNKKFINNEQLTEIARRLVSKVGRRVD 133

Query: 185 ESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQ 244
           +S P+ DAR+ DGSR+NV+I P+ALDG +++IRKF K K TL+ L+ +G++    A  L 
Sbjct: 134 DSQPLVDARMPDGSRLNVVISPIALDGTSISIRKFGKGKKTLNDLIEYGSINEAMANFLV 193

Query: 245 IIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPP 304
           I  R R N+++SGGTGSGKTTLLN L++YI  DER++T ED AEL+L QPH+VRLETR  
Sbjct: 194 IAARSRVNIIVSGGTGSGKTTLLNALSQYISDDERVLTLEDAAELRLLQPHIVRLETRMA 253

Query: 305 NIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARE 364
             E  G ++MR+LV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM T+HAN+ R+
Sbjct: 254 GSENRGVVSMRNLVVNALRMRPDRIIVGECRGEEAFEMLQAMNTGHDGSMSTLHANSPRD 313

Query: 365 SFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVII 424
           +  R+E+M+ M    LP   +R  I S++++I+Q  RL DGSR++ NI E++GMEG  II
Sbjct: 314 ALARLESMVMMSSVGLPLIAIRRNIASAVNLILQVTRLPDGSRKVINITEVMGMEGENII 373

Query: 425 TQDLLKYEVMGE-DETGKLIGQHISTG-VSRPRFWNRAAQYG 464
            QD+  +  + E DE  ++ G   S G + R   +  A  +G
Sbjct: 374 LQDIFTFTAVAERDENDRIKGNFNSFGLLQRSAVYRNAVFHG 415


>gi|115379231|ref|ZP_01466347.1| Flp pilus assembly protein TadA [Stigmatella aurantiaca DW4/3-1]
 gi|310822226|ref|YP_003954584.1| type II secretion system protein e [Stigmatella aurantiaca DW4/3-1]
 gi|115363763|gb|EAU62882.1| Flp pilus assembly protein TadA [Stigmatella aurantiaca DW4/3-1]
 gi|309395298|gb|ADO72757.1| Type II secretion system protein E [Stigmatella aurantiaca DW4/3-1]
          Length = 598

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 194/422 (45%), Positives = 278/422 (65%), Gaps = 6/422 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLS--QYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
           R   Y  ++  I   LIE +D+ ++   +   +         + +I+        L E +
Sbjct: 173 RIERYTRLQKEIHDRLIEYLDLRRMDMDRLGDEELWRRTEKAIRDIIDQMDADQELPEDV 232

Query: 112 D---LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           D   L  D+ N+ LG GPL+  +A D+I++IMVN +N+++IE  GK + +   F  N+ +
Sbjct: 233 DREELLTDVINEALGLGPLEAFLASDEISEIMVNHANQIYIERKGKLIMSEKTFSSNQAV 292

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
           L V +RIV  +GRR+DESSP+ DARL DGSRVN IIPPLAL GP +TIRKFKKD L +  
Sbjct: 293 LGVIERIVAPIGRRIDESSPLVDARLKDGSRVNAIIPPLALKGPCITIRKFKKDSLKIQD 352

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           L+ +  +TA+ A  L++  + R N++ISGGTGSGKTT LN ++ +I  DERIVT ED AE
Sbjct: 353 LIKYKTITAQMAEFLEMCVKARKNIVISGGTGSGKTTTLNIISSFIPDDERIVTVEDAAE 412

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           LQL Q H V+LE+RPPN+EG+G IT+RDLVKNCLRMRP+RI++GE R  E LD+LQAMNT
Sbjct: 413 LQLPQDHWVQLESRPPNLEGKGAITIRDLVKNCLRMRPDRIVVGECRSGETLDMLQAMNT 472

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GHDGS+ T+HAN  R++  R+E M+ M G  LP + +RE I S++ +IVQ  R  DG+R+
Sbjct: 473 GHDGSLTTLHANTPRDAIARLETMVLMSGMELPVKAIREQIASAVHIIVQQTRFSDGTRK 532

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
           I  I E+ GME +++  QD+  Y+  G  E  K+ G+ +++G   P+F++   + G   N
Sbjct: 533 ICFITEVAGMEVDIVTLQDIFYYKQDGFTEDQKVRGRFVASGFV-PKFYDDLQRKGIPVN 591

Query: 469 LA 470
           ++
Sbjct: 592 MS 593


>gi|149188843|ref|ZP_01867133.1| putative Flp pilus assembly protein [Vibrio shilonii AK1]
 gi|148837263|gb|EDL54210.1| putative Flp pilus assembly protein [Vibrio shilonii AK1]
          Length = 424

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 192/411 (46%), Positives = 270/411 (65%), Gaps = 11/411 (2%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSA-RDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           Y   +S IF  L +   I  LSQ + ++  R+ +  L N     + IT  +     L + 
Sbjct: 8   YVAFRSQIFEAL-DPEAIQTLSQKEVENQIRNAVDVLANNFE--RPITAMMKS--GLVKS 62

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + +++ G GP+Q L+    + DI+VN +  VF E NGK   + I+F   EQ+L++ + I 
Sbjct: 63  MMDELFGLGPIQSLVDDPTVTDILVNSATDVFFEKNGKLHRSDISFVSEEQVLAIAKLIA 122

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
            +VGRRVDE SP  DARL DGSRVN++IPP+ALDG +++IRKF++    ++ LV  G+++
Sbjct: 123 ARVGRRVDELSPTVDARLEDGSRVNIVIPPIALDGTSISIRKFREQNFGVEELVEIGSMS 182

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
            + AR+L I  R R N+LISGGTGSGKTTLLN L+ Y++ DERIVT ED AEL+LQQP++
Sbjct: 183 LDMARVLSIASRCRMNILISGGTGSGKTTLLNALSHYVEDDERIVTIEDAAELRLQQPNL 242

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VRLETR  +IE  G +T RDLV N LRMRP+RIILGE RGPE  ++LQAMNTGHDGSM T
Sbjct: 243 VRLETRSASIEETGVVTQRDLVINALRMRPDRIILGECRGPEAFEMLQAMNTGHDGSMST 302

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ R++  R+E+MI M     P   +R  I S++ +IVQ  RLRDGSR++T+I E+V
Sbjct: 303 LHANSPRDAISRVESMIMMANLNQPLDAIRRSIVSAVQLIVQVNRLRDGSRKVTSISEVV 362

Query: 417 GMEGNVIITQDL--LKYEVMGEDETGKLIGQHISTGV-SRPRFWNRAAQYG 464
           G+EG  ++ +++   KYE  G  E  K  G  ++ G+  R     ++  YG
Sbjct: 363 GLEGENVVMEEIYRFKYEESGYGENVK--GSFLTQGIMQRSELVKKSQFYG 411


>gi|27365654|ref|NP_761182.1| type II/IV secretion system ATP hydrolase TadA/VirB11/Cpa [Vibrio
           vulnificus CMCP6]
 gi|27361802|gb|AAO10709.1| Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus CMCP6]
          Length = 430

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 191/420 (45%), Positives = 275/420 (65%), Gaps = 11/420 (2%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           E   T F  LIE  +  +L++   Q    EI   + ++ + + +  +  E   L E LC+
Sbjct: 21  EAAQTAFEKLIEPSEAVKLTRKQLQQ---EIKKAVAQLSAQQLLPYNQSELAILVEQLCD 77

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           D+LG GP+Q L+    ++DI+VNG  +++IE  GK ++T I FRD + LL+V QRIVN V
Sbjct: 78  DMLGVGPIQCLVEDPSVSDILVNGPEQIYIERQGKLLKTDIRFRDKKHLLNVAQRIVNAV 137

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DES+P+ DARL DGSRVN+I PPLAL+G  ++IRKF + +  L  LV+FG+++ E 
Sbjct: 138 GRRLDESTPLVDARLEDGSRVNIIAPPLALNGVCISIRKFPERQYDLPGLVAFGSLSEEM 197

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A+ L +  R R N+L+SGGTG+GKTTLLN ++  I  DERI+T ED AEL L QPH ++L
Sbjct: 198 AQCLALAARCRLNILVSGGTGAGKTTLLNAMSTPISDDERIITIEDAAELSLTQPHWIQL 257

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETR  + EG G +T+RDLVKN LRMRP+RIILGEVRG E  D+LQAMNTGHDGS+ T+HA
Sbjct: 258 ETRTASSEGTGAVTVRDLVKNALRMRPDRIILGEVRGAEAFDMLQAMNTGHDGSLCTLHA 317

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+  ++  R+E M+ MG   +PS ++R+ I+S+LD++VQ +R  DG RR+T I  + G+E
Sbjct: 318 NSPADAMLRLENMLMMGAEQIPSAVLRQQISSALDLVVQLERSHDGKRRVTAISAVGGIE 377

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPR-FWNRAAQYGEEKNLAEVLQSLEK 478
              I+   L  +E   +D+     GQ +    + PR    RA  +  ++    +  + E+
Sbjct: 378 QGQIVVHPL--FECCLDDQ-----GQGVYQQGTLPRNLLERARHFALDRQWQALFSNEER 430


>gi|51597673|ref|YP_071864.1| type IV secretion ATPase [Yersinia pseudotuberculosis IP 32953]
 gi|51590955|emb|CAH22613.1| Putative type IV secretion ATPase [Yersinia pseudotuberculosis IP
           32953]
          Length = 428

 Score =  362 bits (928), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 255/367 (69%), Gaps = 8/367 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + E + ++I G+GPL+ L+  D I+DIMVNG  ++FIE  G    T   F +N QL  + 
Sbjct: 61  IIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLKLTDRRFVNNTQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++ +V RR+DE  P+ DARL+DGSR+NV I P+ALDG TL+IRKF K+K  L+ LV  
Sbjct: 121 KRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTTLSIRKFSKNKRRLEDLVDM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI +DER++T ED AEL L+
Sbjct: 181 GAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYISEDERVITLEDAAELNLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR+I NI
Sbjct: 301 SMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASAINLIVQVSRMNDGSRKIRNI 360

Query: 413 CEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQY--GEEKNL 469
            EI+GMEG  ++ QD+  ++     D+ G++ G+ I+ G+     +NR++     +  NL
Sbjct: 361 SEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHGL-----FNRSSVRINADIHNL 415

Query: 470 AEVLQSL 476
           A  L S+
Sbjct: 416 ANELNSV 422


>gi|54302283|ref|YP_132276.1| putative pilus assembly protein [Photobacterium profundum SS9]
 gi|46915705|emb|CAG22476.1| putative pilus assembly protein [Photobacterium profundum SS9]
          Length = 462

 Score =  362 bits (928), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 200/404 (49%), Positives = 282/404 (69%), Gaps = 1/404 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  +   L   +D++ +   D + A+++I    + ++  + + ++ D ++ +  ++ ++
Sbjct: 43  IKKNLLEELFNSLDLSLIETLDREQAKEQIFDAASTLLLDQNVPLNADARIRIINEIIDE 102

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ILG GPL+PL+    I+DI+VNG   ++IE  GK   T   FRD+  LL+V  RIV+ VG
Sbjct: 103 ILGLGPLEPLLKDPTISDILVNGHASIYIERKGKLEATEAQFRDDAHLLNVIDRIVSLVG 162

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DESSP+ DARL DGSRVN IIPPLA+DGP+L+IR+F  +KL ++ L+ +G++    A
Sbjct: 163 RRIDESSPMVDARLKDGSRVNAIIPPLAIDGPSLSIRRFAVEKLDIEQLLDYGSLNKPMA 222

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
            LLQ I + R NVLISGGTGSGKTT LN  + +I  +ERI+T ED+AELQLQQPHVVRLE
Sbjct: 223 DLLQAIVKGRLNVLISGGTGSGKTTTLNICSSFIPSNERIITIEDSAELQLQQPHVVRLE 282

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPNIEG G IT R+LV N LRMRP+RI++GEVRG E +D+L AMNTGHDGSM TIHAN
Sbjct: 283 TRPPNIEGSGAITQRELVINSLRMRPDRIVVGEVRGGEAVDMLAAMNTGHDGSMTTIHAN 342

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++ GR+E M AM G+ +P + VR  I S++ ++VQ +R+ DG RRIT+I E+ GMEG
Sbjct: 343 TPRDALGRIENMFAMAGWNMPIKNVRAQIASAIHIVVQLRRMEDGKRRITSIVELNGMEG 402

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +V+   +L  ++ MG DE G ++G + +TG + P F       G
Sbjct: 403 DVVTMTELFCFKRMGIDEQGNVLGNYQATG-NVPSFIEAFKHMG 445


>gi|261820217|ref|YP_003258323.1| type II secretion system protein E [Pectobacterium wasabiae WPP163]
 gi|261604230|gb|ACX86716.1| type II secretion system protein E [Pectobacterium wasabiae WPP163]
          Length = 467

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 271/425 (63%), Gaps = 1/425 (0%)

Query: 38  QSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEI 97
           Q ++ ++ G       +T +    +  I   L + ID  + +         +I T++  I
Sbjct: 39  QPAANTSSGSAAPTARQTDNRTSQRRIIRAQLYDQIDAGKAAMMGRDKLLVQIETVIRRI 98

Query: 98  VSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
              +++ +S  E+  +  ++ +++ G GP+QPL++ D + DI+VNG+ +VF+E  GK   
Sbjct: 99  CDEQRLQLSRQEEEAIATEMLDEMTGIGPIQPLLSDDTVNDILVNGAGQVFVERFGKLEL 158

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           + I F D E + +  QRI   VGRR+DE+SP+ DARL DGSRVNVI  PLA+DG T++IR
Sbjct: 159 SPITFIDEEHVFNTAQRIAAAVGRRIDEASPMVDARLPDGSRVNVITYPLAIDGTTISIR 218

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KF +  L+L+ L     ++   A +L    + R NV++SGGTG+GKTTLLN L++ I   
Sbjct: 219 KFMRRNLSLEMLAERRCMSYAMADVLNKAMQARVNVIVSGGTGAGKTTLLNALSQKIGST 278

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
           +RI+T ED AELQLQQ HVVRLETRP + EG G I  RDL++N LRMRP+RIILGEVRG 
Sbjct: 279 DRIITIEDAAELQLQQEHVVRLETRPVSAEGTGRIDQRDLMRNALRMRPDRIILGEVRGG 338

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
           E  D+LQAMNTGHDGS+ T+HAN +R++  R+E M+ M    LP   +R  I S++ +IV
Sbjct: 339 ESFDMLQAMNTGHDGSLCTVHANTSRDAIQRLENMVMMANMQLPLMAIRRQIASAVHLIV 398

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           Q +R+RDG RR+ +I E+ GME  VI  QDL  + + G D  G L G+++   + RP+F+
Sbjct: 399 QIERMRDGMRRVVSITEVCGMENEVIQLQDLFSFNIQGMDGQGLLTGEYVQH-MQRPQFY 457

Query: 458 NRAAQ 462
           +  A 
Sbjct: 458 SDKAH 462


>gi|323491538|ref|ZP_08096717.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
 gi|323314114|gb|EGA67199.1| Flp pilus assembly protein [Vibrio brasiliensis LMG 20546]
          Length = 495

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 247/339 (72%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + + + +++ G GPL+PL+    ++DI+VNG   VF+E  GK   T   F D   L ++ 
Sbjct: 133 VIQQIEDEVFGLGPLEPLLKDATVSDILVNGPKHVFVERRGKLELTPYTFLDERHLRNII 192

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
            R+V+QVGRR+DE+SP+ DARL DGSRVN IIPPLALDG +++IR+F  +KL +D+L++F
Sbjct: 193 DRVVSQVGRRIDEASPMVDARLADGSRVNAIIPPLALDGSSVSIRRFAVEKLNMDNLLNF 252

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
            +++ E A+ ++   R   NVLISGGTGSGKTT LN  + +I  D+RIVT ED+AELQLQ
Sbjct: 253 NSLSPEMAKFVEAAVRGAMNVLISGGTGSGKTTTLNIFSNFIPSDDRIVTIEDSAELQLQ 312

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVRLETRP N+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDG
Sbjct: 313 QPHVVRLETRPANLEGKGEITQRDLVKNSLRMRPDRIVLGEVRGAEAVDMLAAMNTGHDG 372

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ +I
Sbjct: 373 SLATIHANTPRDALSRVENMFAMAGWNMTAKNLRSQIASAIHLVVQMERQEDGKRRMVSI 432

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           CEI GMEG +I   ++ K++  G DE G + G   +TGV
Sbjct: 433 CEINGMEGEIITMSEIFKFQRKGMDEEGNVRGHFTATGV 471


>gi|218710400|ref|YP_002418021.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
 gi|218323419|emb|CAV19596.1| Flp pilus assembly protein [Vibrio splendidus LGP32]
          Length = 484

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 176/346 (50%), Positives = 258/346 (74%), Gaps = 1/346 (0%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+A   ++DI+VNG   V++E  GK  +T   F D+  L ++  RIV+Q
Sbjct: 127 DEVFGLGPLEPLLADQTVSDILVNGPKSVYVERRGKLEKTPYTFLDDRHLRNIIDRIVSQ 186

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL+DGSRVN IIPPLALDGP+++IR+F  D+LT+D+L+S+ +V+ +
Sbjct: 187 VGRRIDEASPMVDARLVDGSRVNAIIPPLALDGPSVSIRRFAVDRLTMDNLISYDSVSPQ 246

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   +   N+LISGGTGSGKTT LN  + +I +D+RI+T ED+AELQLQQPHV+R
Sbjct: 247 MAKFVEAAVKGELNILISGGTGSGKTTTLNIFSGFIPRDQRIITIEDSAELQLQQPHVIR 306

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEI+ R+LVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 307 LETRPANLEGKGEISQRELVKNTLRMRPDRIVVGEVRGSEAVDMLAAMNTGHDGSLATIH 366

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S++ ++VQ +R  DG RR+ +I EI GM
Sbjct: 367 ANTPRDALSRVENMFSMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSIQEINGM 426

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EG VI   ++ +++  G DE G +IG   +TG+  P++ ++  + G
Sbjct: 427 EGEVITMSEIFRFQRKGIDEDGNIIGYFTATGIV-PQYHDQLVKRG 471


>gi|260776712|ref|ZP_05885607.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607935|gb|EEX34200.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio coralliilyticus ATCC BAA-450]
          Length = 496

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 245/333 (73%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    ++DI+VNG  KVF+E  GK   T   F D   L ++  RIV+Q
Sbjct: 139 DEVFGLGPLEPLLNDATVSDILVNGPKKVFVERRGKLELTPYTFLDERHLRNIIDRIVSQ 198

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL+DGSRVN IIPPLALDG +++IR+F  +KL +++L+SF +++ E
Sbjct: 199 VGRRIDEASPMVDARLVDGSRVNAIIPPLALDGASVSIRRFAVEKLNMENLLSFNSLSPE 258

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++       NVLISGGTGSGKTT LN  + +I  D+RIVT ED+AELQLQQPHVVR
Sbjct: 259 MAKFVEAAVNGALNVLISGGTGSGKTTTLNIFSGFIPSDDRIVTIEDSAELQLQQPHVVR 318

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 319 LETRPANLEGKGEITQRDLVKNSLRMRPDRIVLGEVRGAEAVDMLAAMNTGHDGSLATIH 378

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ +ICEI GM
Sbjct: 379 ANTPRDALSRVENMFAMAGWNMSAKNLRAQIASAIHLVVQMERQEDGKRRMVSICEINGM 438

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG +I   ++ K+   G DE G ++G   +TGV
Sbjct: 439 EGEIITMSEIFKFHRKGLDEDGNVLGYFTATGV 471


>gi|296131923|ref|YP_003639170.1| type II secretion system protein E [Thermincola sp. JR]
 gi|296030501|gb|ADG81269.1| type II secretion system protein E [Thermincola potens JR]
          Length = 445

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 190/445 (42%), Positives = 294/445 (66%), Gaps = 9/445 (2%)

Query: 36  NLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMN 95
           +L++S   ++ +I + ++    +Y+ +      L++  D+ QL++      R  I   + 
Sbjct: 9   SLKASGAKSDSQINDHLDTLSKHYKER------LLKECDLNQLTKLSPLQLRLAIERKVT 62

Query: 96  EIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKT 155
           E+++ +K+ +S  ++  L   + N+ +GYGPL+PL+  D++ +IMVNG ++V++E NGKT
Sbjct: 63  EMMADEKLIISHGDKSRLLALILNESVGYGPLEPLLKDDEVTEIMVNGPDEVYVEKNGKT 122

Query: 156 VETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLT 215
             T   F+D++ +  + +RI+  +GRR+DESSP+ DARL DGSRVN +IPP++L+GP ++
Sbjct: 123 YLTDTTFKDHDHIRHIIERIIAPIGRRIDESSPMVDARLRDGSRVNAVIPPVSLNGPVIS 182

Query: 216 IRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYID 275
           IRKF KD  +++ L+ FG++T E A  LQ   + + N++ISGGTGSGKTT LN L+  I 
Sbjct: 183 IRKFNKDPFSMEDLIGFGSLTTEMAVFLQAAVKAKLNIVISGGTGSGKTTFLNVLSSAIP 242

Query: 276 KDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVR 335
            +ERI+T ED AEL+L + +VVRLE RP N+EG GEIT+R LVKN LRMRP+RI++GEVR
Sbjct: 243 VNERIITIEDMAELRLNRSNVVRLEARPQNVEGTGEITIRQLVKNALRMRPDRIVVGEVR 302

Query: 336 GPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDV 395
             E LD+LQAMNTGH+GS+ T+HANN R+   R+EAM+ M   +L   +VR  I S++D+
Sbjct: 303 SGEALDMLQAMNTGHEGSLTTVHANNPRDCLSRIEAMVVMNNESLSVSVVRYYILSAIDL 362

Query: 396 IVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPR 455
           IVQT+R+ DG+R++ NI E+   +    I + +  ++  G    G ++G H +TG   P 
Sbjct: 363 IVQTERMSDGTRKVVNIAEVHEDQDKPRI-EPIFIFKRQGTLPDGTVVGYHTATGFV-PA 420

Query: 456 FWNRAAQYGEEKNLAEVLQSLEKQS 480
              R   +G+E  L  V Q  E Q+
Sbjct: 421 CVERLKAFGQEIPL-HVFQVKEGQN 444


>gi|283778866|ref|YP_003369621.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
 gi|283437319|gb|ADB15761.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
          Length = 476

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 253/380 (66%), Gaps = 1/380 (0%)

Query: 87  RDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNK 146
           R++I  L   ++  +   +   ++  L E+L  +  G GPL+  +   D+ DI+VNG ++
Sbjct: 60  REDIRRLAETMLRTRSRKLPAIDEERLVEELIAESFGLGPLEVYMQDPDVTDILVNGPHE 119

Query: 147 VFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPP 206
           V++E  G+  ET   F D E LL + QR+V +VGRR+DE SP+CDARL DGSRVN IIPP
Sbjct: 120 VYVERLGRLQETNTVFADEEHLLQIIQRVVARVGRRIDEHSPMCDARLPDGSRVNAIIPP 179

Query: 207 LALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTL 266
           LAL GP L+IR+F    L ++ L++ G++  E   LL+     R N++ISGGTGSGKTT+
Sbjct: 180 LALGGPVLSIRRFGHRPLQVNDLLTRGSICPEMLELLEAAIEGRINIMISGGTGSGKTTM 239

Query: 267 LNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRP 326
           LN L+R+I   ER+VT ED+AEL LQ+ HVV+LETRP + EG  EI+ RDLV+N LRMRP
Sbjct: 240 LNNLSRFIPGGERLVTIEDSAELLLQRKHVVKLETRPKSAEGASEISQRDLVRNALRMRP 299

Query: 327 ERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVR 386
           +RIILGEVRG E LD+LQAMNTGH+GSM TIHAN+ R++  R+E M++M GF LP  +VR
Sbjct: 300 DRIILGEVRGGEALDMLQAMNTGHEGSMSTIHANDTRDALSRLEVMVSMAGFDLPVPVVR 359

Query: 387 EIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQH 446
             I S++ ++V   RL+ G RR+  I EI  +E    + QDL  ++  G D+ G   G  
Sbjct: 360 RYIASAVTLVVHLSRLKGGVRRVMRISEITALESGDYVIQDLFGFQQSGIDDRGIARGHF 419

Query: 447 ISTGVSRPRFWNRAAQYGEE 466
            +TG+ +P F  R  + G E
Sbjct: 420 YATGI-KPNFAKRLKEVGIE 438


>gi|258627498|ref|ZP_05722279.1| Flp pilus assembly protein [Vibrio mimicus VM603]
 gi|258580304|gb|EEW05272.1| Flp pilus assembly protein [Vibrio mimicus VM603]
          Length = 495

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 255/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 124 MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 183

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 184 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 243

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 244 TMDNMLGYNSLSPQMAKFVEAAVQGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 303

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 304 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 363

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M+AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 364 AMNTGHDGSLATIHANTPRDALSRVENMLAMAGWNISTKNLRAQIASAIHLVVQMERQED 423

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G +IG + +TGV
Sbjct: 424 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGVDAEGNIIGFYTATGV 470


>gi|37680837|ref|NP_935446.1| Flp pilus assembly protein TadA [Vibrio vulnificus YJ016]
 gi|37199586|dbj|BAC95417.1| Flp pilus assembly protein TadA [Vibrio vulnificus YJ016]
          Length = 495

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 254/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 124 MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 183

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 184 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 243

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 244 TMDNMLGYNSLSPQMAKFVEAAVKGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 303

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 304 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 363

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 364 AMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQED 423

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G ++G + +TGV
Sbjct: 424 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGLDADGNILGYYTATGV 470


>gi|90411200|ref|ZP_01219213.1| putative pilus assembly protein [Photobacterium profundum 3TCK]
 gi|90328046|gb|EAS44367.1| putative pilus assembly protein [Photobacterium profundum 3TCK]
          Length = 468

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 198/404 (49%), Positives = 283/404 (70%), Gaps = 1/404 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           +K  +   L   +D++ +   D + A+++I    + ++  + + ++ D ++ +  ++ ++
Sbjct: 49  IKKNLLEELFNSLDLSLIETLDREQAKEQIFDAASTLLLDQNVPLNADGRIRIINEIIDE 108

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ILG GPL+PL+    I+DI+VNG + ++IE  GK   T   FRD+  LL+V  RIV+ VG
Sbjct: 109 ILGLGPLEPLLKDPTISDILVNGHDSIYIERKGKLEATEAQFRDDAHLLNVIDRIVSLVG 168

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DESSP+ DARL DGSRVN IIPPLA+DGP+L+IR+F  +KL ++ L+ +G++    A
Sbjct: 169 RRIDESSPMVDARLKDGSRVNAIIPPLAIDGPSLSIRRFAVEKLNIEQLLDYGSLNKPMA 228

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
            LLQ I + R N+LISGGTGSGKTT LN  + +I  +ERI+T ED+AELQLQQPHVVRLE
Sbjct: 229 DLLQAIVKGRLNILISGGTGSGKTTTLNICSSFIPSNERIITIEDSAELQLQQPHVVRLE 288

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRPPNIEG G IT R+LV N LRMRP+RI++GEVRG E +D+L AMNTGHDGSM TIHAN
Sbjct: 289 TRPPNIEGSGAITQRELVINSLRMRPDRIVVGEVRGGEAVDMLAAMNTGHDGSMTTIHAN 348

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++ GR+E M AM G+ +P + VR  I S++ ++VQ +R+ DG RRIT+I E+ GMEG
Sbjct: 349 TPRDALGRIENMFAMAGWNMPIKNVRAQIASAVHIVVQLRRMEDGKRRITSIVELNGMEG 408

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +V+   +L  ++ MG D+ G ++G + +TG + P F       G
Sbjct: 409 DVVTMTELFCFKRMGIDKQGNVLGNYQATG-NVPSFVEAFKHMG 451


>gi|258621453|ref|ZP_05716487.1| Flp pilus assembly protein [Vibrio mimicus VM573]
 gi|258586841|gb|EEW11556.1| Flp pilus assembly protein [Vibrio mimicus VM573]
          Length = 495

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 254/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 124 MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 183

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 184 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 243

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 244 TMDNMLGYNSLSPQMAKFVEAAVQGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 303

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 304 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 363

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 364 AMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQED 423

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G +IG + +TGV
Sbjct: 424 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGVDAEGNIIGFYTATGV 470


>gi|50119737|ref|YP_048904.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610263|emb|CAG73706.1| putative type IV pilus protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 467

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 178/374 (47%), Positives = 254/374 (67%), Gaps = 1/374 (0%)

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           +I T++  I   +++ +S  E+  +  ++ +++ G GP+QPL++ D + DI+VNG+ +VF
Sbjct: 90  QIETVIRRICDEQRLQLSRQEEEAIAAEMLDEMTGIGPIQPLLSDDSVNDILVNGAGQVF 149

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E  GK   + I F D E + +  QRI   VGRR+DE+SP+ DARL DGSRVNVI  PLA
Sbjct: 150 VERFGKLELSPITFIDEEHVFNTAQRIAAAVGRRIDEASPMVDARLPDGSRVNVITYPLA 209

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           +DG T++IRKF +  L+L+ L     ++   A +L    + R NV++SGGTG+GKTTLLN
Sbjct: 210 IDGTTISIRKFMRRNLSLEMLAERRCMSYAMADVLNKAMQARVNVIVSGGTGAGKTTLLN 269

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L++ I   +RI+T ED AELQLQQ HVVRLETRP + EG G +  RDL++N LRMRP+R
Sbjct: 270 ALSQKIGTTDRIITIEDAAELQLQQEHVVRLETRPVSAEGTGRVDQRDLMRNALRMRPDR 329

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           IILGEVRG E  D+LQAMNTGHDGS+ T+HAN +R++  R+E M+ M    LP   +R  
Sbjct: 330 IILGEVRGGESFDMLQAMNTGHDGSLCTVHANTSRDAIQRLENMVMMANMQLPLMAIRRQ 389

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIS 448
           I S++ +IVQ +R+RDG RR+ +I E+ GME  VI  QDL  + + G D  G L G+++ 
Sbjct: 390 IASAVHLIVQIERMRDGMRRVVSITEVCGMENEVIQLQDLFSFNIQGMDGQGLLTGEYVQ 449

Query: 449 TGVSRPRFWNRAAQ 462
             + RP+F++  A 
Sbjct: 450 H-IQRPQFYSDKAH 462


>gi|262165916|ref|ZP_06033653.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus VM223]
 gi|262025632|gb|EEY44300.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus VM223]
          Length = 495

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 254/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 124 MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 183

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 184 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 243

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 244 TMDNMLGYNSLSPQMAKFVEAAVQGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 303

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 304 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 363

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 364 AMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQED 423

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G +IG + +TGV
Sbjct: 424 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGVDAEGNIIGFYTATGV 470


>gi|84387239|ref|ZP_00990260.1| Flp pilus assembly protein TadA [Vibrio splendidus 12B01]
 gi|84377886|gb|EAP94748.1| Flp pilus assembly protein TadA [Vibrio splendidus 12B01]
          Length = 482

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/346 (50%), Positives = 257/346 (74%), Gaps = 1/346 (0%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+A   ++DI+VNG   V++E  GK  +T   F D+  L ++  RIV+Q
Sbjct: 125 DEVFGLGPLEPLLADQTVSDILVNGPKSVYVERRGKLEKTPYTFLDDRHLRNIIDRIVSQ 184

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL+DGSRVN IIPPLALDGP+++IR+F  D+LT+D+L+ + +V+ +
Sbjct: 185 VGRRIDEASPMVDARLVDGSRVNAIIPPLALDGPSVSIRRFAVDRLTMDNLIGYDSVSPQ 244

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   +   N+LISGGTGSGKTT LN  + +I +D+RI+T ED+AELQLQQPHV+R
Sbjct: 245 MAKFVEAAVKGELNILISGGTGSGKTTTLNIFSGFIPRDQRIITIEDSAELQLQQPHVIR 304

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEI+ R+LVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 305 LETRPANLEGKGEISQRELVKNTLRMRPDRIVVGEVRGSEAVDMLAAMNTGHDGSLATIH 364

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S++ ++VQ +R  DG RR+ +I EI GM
Sbjct: 365 ANTPRDALSRVENMFSMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSIQEINGM 424

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           EG VI   ++ +++  G DE G +IG   +TGV  P++ ++  + G
Sbjct: 425 EGEVITMSEIFRFQRKGIDEDGNIIGYFTATGVV-PQYHDQLVKRG 469


>gi|170022931|ref|YP_001719436.1| type II secretion system protein E [Yersinia pseudotuberculosis
           YPIII]
 gi|169749465|gb|ACA66983.1| type II secretion system protein E [Yersinia pseudotuberculosis
           YPIII]
          Length = 428

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 254/367 (69%), Gaps = 8/367 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + E + ++I G+GPL+ L+  D I+DIMVNG  ++FIE  G    T   F +N QL  + 
Sbjct: 61  IIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLKLTDRRFVNNTQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++ +V RR+DE  P+ DARL+DGSR+NV I P+ALDG  L+IRKF K+K  L+ LV  
Sbjct: 121 KRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALSIRKFSKNKRRLEDLVDM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI +DER++T ED AEL L+
Sbjct: 181 GAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYISEDERVITLEDAAELNLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR+I NI
Sbjct: 301 SMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASAINLIVQVSRMNDGSRKIRNI 360

Query: 413 CEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQY--GEEKNL 469
            EI+GMEG  ++ QD+  ++     D+ G++ G+ I+ G+     +NR++     +  NL
Sbjct: 361 SEIMGMEGEHVVLQDIFTFQPASTRDDKGRIQGEFINHGL-----FNRSSVRINADIHNL 415

Query: 470 AEVLQSL 476
           A  L S+
Sbjct: 416 ANELNSV 422


>gi|283777930|ref|YP_003368685.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
 gi|283436383|gb|ADB14825.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
          Length = 473

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 190/405 (46%), Positives = 271/405 (66%), Gaps = 1/405 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           ++K  +   LI+ ID+      D Q  R E      E+   +   +SL E+  + E+L +
Sbjct: 25  QLKRELHNRLIQGIDLAAFRSMDEQQLRIEFRRGAEELCRQRPDLISLTERKRIIEELVD 84

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           + LG GPL+PL+    ++DI++NG  +VF+E  GK V++ + F  +E LL V Q+IV++V
Sbjct: 85  ETLGLGPLEPLLRDPTVSDILINGPRQVFVERGGKLVKSSLQFYSDEHLLQVVQKIVSRV 144

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDESSP+ DARL DGSRVN II PLALDG  ++IR+F + ++  + LV  G+++ E 
Sbjct: 145 GRRVDESSPMVDARLPDGSRVNAIIRPLALDGALVSIRRFGQTRMGPEQLVQSGSISREM 204

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
              +    + R N+L+SGGTGSGKTTLLN L+ +I  D+R+VT ED AELQLQQPHV R+
Sbjct: 205 MCFMAAAVQARLNILVSGGTGSGKTTLLNILSSFIQPDQRLVTIEDAAELQLQQPHVARM 264

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP N+EG GE++ RDL++N LRMRP+RII+GE RG E LD+LQAMNTGHDGS+ TIHA
Sbjct: 265 ETRPANLEGSGEVSARDLLRNALRMRPDRIIVGECRGGEALDMLQAMNTGHDGSLTTIHA 324

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N A ++  R+E ++ M GF LP   +   I S + ++VQT RL  G RR+T I E+ G++
Sbjct: 325 NTAHDALCRLEMLVGMSGFELPMWYIDRQIASGIQLVVQTARLCGGVRRVTQIAEVCGVQ 384

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
              ++T+DL ++E  G D  G+ +G   + GV  P+ ++R   YG
Sbjct: 385 QGQLVTRDLFQFEQTGVDSLGQAVGIFKACGVL-PKCFSRLKSYG 428


>gi|165939865|ref|ZP_02228404.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008752|ref|ZP_02229650.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166212059|ref|ZP_02238094.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167419028|ref|ZP_02310781.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425208|ref|ZP_02316961.1| type II/IV secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|294502756|ref|YP_003566818.1| type II secretion protein [Yersinia pestis Z176003]
 gi|165912176|gb|EDR30814.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165992091|gb|EDR44392.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166206805|gb|EDR51285.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166963022|gb|EDR59043.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167055971|gb|EDR65752.1| type II/IV secretion system protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|294353215|gb|ADE63556.1| type II secretion protein [Yersinia pestis Z176003]
          Length = 414

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 254/367 (69%), Gaps = 8/367 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + E + ++I G+GPL+ L+  D I+DIMVNG  ++FIE  G    T   F +N QL  + 
Sbjct: 47  IIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLKLTDRRFVNNTQLTDIA 106

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++ +V RR+DE  P+ DARL+DGSR+NV I P+ALDG  L+IRKF K+K  L+ LV  
Sbjct: 107 KRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALSIRKFSKNKRRLEDLVDM 166

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI +DER++T ED AEL L+
Sbjct: 167 GAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYISEDERVITLEDAAELNLE 226

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 227 QPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 286

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR+I NI
Sbjct: 287 SMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASAINLIVQVSRMNDGSRKIRNI 346

Query: 413 CEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQY--GEEKNL 469
            EI+GMEG  ++ QD+  ++     D+ G++ G+ I+ G+     +NR++     +  NL
Sbjct: 347 SEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHGL-----FNRSSVRINADIHNL 401

Query: 470 AEVLQSL 476
           A  L S+
Sbjct: 402 ANELNSV 408


>gi|332162956|ref|YP_004299533.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|325667186|gb|ADZ43830.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330862291|emb|CBX72452.1| hypothetical protein YEW_HH31840 [Yersinia enterocolitica W22703]
          Length = 414

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 264/387 (68%), Gaps = 5/387 (1%)

Query: 69  LIEMIDITQLSQY---DSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYG 125
           ++  IDI Q+ QY   D     + ++  ++E+ +     ++  +Q  +   + ++I G+G
Sbjct: 1   MLASIDIDQV-QYLVDDYSKLSELLSQTLDELFNNNDYKLTTQDQKKIITMIADEITGFG 59

Query: 126 PLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDE 185
           PL+ L+  D I+DIMVNG  K+FIE  G    T   F +NEQL  + +R++ +  RR+DE
Sbjct: 60  PLRELMEDDSISDIMVNGPEKIFIERFGMITLTSRRFINNEQLTDIAKRLMQRANRRIDE 119

Query: 186 SSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQI 245
             P+ DARL+DGSR+NV I P+ALDG  L+IRKF  +K  L+ LV  GA++++ A  L I
Sbjct: 120 GRPLADARLIDGSRINVAISPIALDGTVLSIRKFSNNKRKLEDLVDMGAMSSDMANFLII 179

Query: 246 IGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPN 305
               R NV+ISGGTGSGKTTLLN L+ YI ++ER++T ED AEL L+QPHVVR+ETR   
Sbjct: 180 AASCRVNVIISGGTGSGKTTLLNALSMYISENERVITLEDAAELNLEQPHVVRMETRLAG 239

Query: 306 IEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARES 365
           +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+GSM T+HAN  R++
Sbjct: 240 LENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNGSMSTLHANTPRDA 299

Query: 366 FGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIIT 425
             R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR++++I EI+GMEG+ +I 
Sbjct: 300 VARLESMIMMGPVNMPILTIRRNIASAINLIVQVSRMNDGSRKLSHISEIMGMEGDNVIL 359

Query: 426 QDLLKYEVMGE-DETGKLIGQHISTGV 451
           QD+  ++ + E  + GK+ G+ I+ G+
Sbjct: 360 QDIFSFKPVKERGQEGKIQGEFINHGL 386


>gi|22127361|ref|NP_670784.1| secretion NTP hydrolase [Yersinia pestis KIM 10]
 gi|45442767|ref|NP_994306.1| putative type II secretion protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108809093|ref|YP_653009.1| putative type II secretion protein [Yersinia pestis Antiqua]
 gi|108810712|ref|YP_646479.1| type II secretion protein [Yersinia pestis Nepal516]
 gi|145597784|ref|YP_001161860.1| type II secretion protein [Yersinia pestis Pestoides F]
 gi|150260280|ref|ZP_01917008.1| putative type IV secretion ATPase [Yersinia pestis CA88-4125]
 gi|153947398|ref|YP_001399592.1| type II/IV secretion system protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162418353|ref|YP_001604878.1| type II/IV secretion system protein [Yersinia pestis Angola]
 gi|165924954|ref|ZP_02220786.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|167398418|ref|ZP_02303942.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167466378|ref|ZP_02331082.1| type II/IV secretion system protein [Yersinia pestis FV-1]
 gi|186896811|ref|YP_001873923.1| type II secretion system protein E [Yersinia pseudotuberculosis
           PB1/+]
 gi|218927881|ref|YP_002345756.1| putative type II secretion protein [Yersinia pestis CO92]
 gi|229837372|ref|ZP_04457535.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis Pestoides A]
 gi|229840584|ref|ZP_04460743.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842866|ref|ZP_04463018.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229900909|ref|ZP_04516033.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis Nepal516]
 gi|270487714|ref|ZP_06204788.1| type II/IV secretion system protein [Yersinia pestis KIM D27]
 gi|21960446|gb|AAM87035.1|AE013952_2 putative secretion NTP hydrolase [Yersinia pestis KIM 10]
 gi|45437633|gb|AAS63183.1| putative type II secretion protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108774360|gb|ABG16879.1| type II secretion protein [Yersinia pestis Nepal516]
 gi|108781006|gb|ABG15064.1| putative type II secretion protein [Yersinia pestis Antiqua]
 gi|115346492|emb|CAL19366.1| putative type II secretion protein [Yersinia pestis CO92]
 gi|145209480|gb|ABP38887.1| type II secretion protein [Yersinia pestis Pestoides F]
 gi|149289688|gb|EDM39765.1| putative type IV secretion ATPase [Yersinia pestis CA88-4125]
 gi|152958893|gb|ABS46354.1| type II/IV secretion system protein [Yersinia pseudotuberculosis IP
           31758]
 gi|162351168|gb|ABX85116.1| type II/IV secretion system protein [Yersinia pestis Angola]
 gi|165923154|gb|EDR40305.1| type II/IV secretion system protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|167050922|gb|EDR62330.1| type II/IV secretion system protein [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|186699837|gb|ACC90466.1| type II secretion system protein E [Yersinia pseudotuberculosis
           PB1/+]
 gi|229682248|gb|EEO78340.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis Nepal516]
 gi|229690133|gb|EEO82190.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696950|gb|EEO86997.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229705495|gb|EEO91505.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis Pestoides A]
 gi|262360788|gb|ACY57509.1| putative type II secretion protein [Yersinia pestis D106004]
 gi|262364733|gb|ACY61290.1| putative type II secretion protein [Yersinia pestis D182038]
 gi|270336218|gb|EFA46995.1| type II/IV secretion system protein [Yersinia pestis KIM D27]
          Length = 428

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 254/367 (69%), Gaps = 8/367 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + E + ++I G+GPL+ L+  D I+DIMVNG  ++FIE  G    T   F +N QL  + 
Sbjct: 61  IIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLKLTDRRFVNNTQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++ +V RR+DE  P+ DARL+DGSR+NV I P+ALDG  L+IRKF K+K  L+ LV  
Sbjct: 121 KRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALSIRKFSKNKRRLEDLVDM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI +DER++T ED AEL L+
Sbjct: 181 GAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYISEDERVITLEDAAELNLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR+I NI
Sbjct: 301 SMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASAINLIVQVSRMNDGSRKIRNI 360

Query: 413 CEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQY--GEEKNL 469
            EI+GMEG  ++ QD+  ++     D+ G++ G+ I+ G+     +NR++     +  NL
Sbjct: 361 SEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHGL-----FNRSSVRINADIHNL 415

Query: 470 AEVLQSL 476
           A  L S+
Sbjct: 416 ANELNSV 422


>gi|27365112|ref|NP_760640.1| type II/IV secretion system ATP hydrolase TadA/VirB11/Cpa [Vibrio
           vulnificus CMCP6]
 gi|320155495|ref|YP_004187874.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus MO6-24/O]
 gi|27361258|gb|AAO10167.1| Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus CMCP6]
 gi|319930807|gb|ADV85671.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Vibrio vulnificus MO6-24/O]
          Length = 495

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 254/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 124 MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 183

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 184 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 243

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 244 TMDNMLGYNSLSPQMAKFVEAAVKGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 303

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 304 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 363

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 364 AMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQED 423

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G ++G + +TGV
Sbjct: 424 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGLDADGNILGFYTATGV 470


>gi|253687071|ref|YP_003016261.1| type II secretion system protein E [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753649|gb|ACT11725.1| type II secretion system protein E [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 466

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 177/370 (47%), Positives = 253/370 (68%), Gaps = 1/370 (0%)

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           +I T++  I   +++ +S  E+  +  ++ +++ G GP+QPL++ D + DI+VNG+ +VF
Sbjct: 89  QIETVIRRICDEQRLQLSRQEEEAIAAEMLDEMTGIGPIQPLLSDDTVNDILVNGAGQVF 148

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E  GK   + I F D E + +  QRI   VGRR+DE+SP+ DARL DGSRVNVI  PLA
Sbjct: 149 VERFGKLELSPITFIDEEHVFNTAQRIAAAVGRRIDEASPMVDARLPDGSRVNVITYPLA 208

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           +DG T++IRKF +  L+L+ L     ++   A +L    + R NV++SGGTG+GKTTLLN
Sbjct: 209 IDGTTISIRKFMRRNLSLEMLAERRCMSYAMADVLNKAMQARVNVIVSGGTGAGKTTLLN 268

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L++ I   +RI+T ED AELQLQQ HVVRLETRP + EG G +  RDL++N LRMRP+R
Sbjct: 269 ALSQKIGSTDRIITIEDAAELQLQQEHVVRLETRPVSAEGTGRVDQRDLMRNALRMRPDR 328

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           IILGEVRG E  D+LQAMNTGHDGS+ T+HAN +R++  R+E M+ M    LP   +R  
Sbjct: 329 IILGEVRGGESFDMLQAMNTGHDGSLCTVHANTSRDAIQRLENMVMMANMQLPLMAIRRQ 388

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIS 448
           I S++ +IVQ +R+RDG RR+ +I E+ GME  VI  QDL  + + G D  G L G+++ 
Sbjct: 389 IASAVHLIVQIERMRDGMRRVVSITEVCGMENEVIQLQDLFSFNIQGMDGQGLLTGEYVQ 448

Query: 449 TGVSRPRFWN 458
             + RP+F++
Sbjct: 449 H-IQRPQFYS 457


>gi|227114879|ref|ZP_03828535.1| putative type IV pilus protein [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 467

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 178/374 (47%), Positives = 254/374 (67%), Gaps = 1/374 (0%)

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           +I T++  I   +++ +S  E+  +  ++ +++ G GP+QPL++ D + DI+VNG+ +VF
Sbjct: 90  QIETVIRRICDEQRLQLSRQEEEAIATEMLDEMTGIGPIQPLLSDDTVNDILVNGAGQVF 149

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E  GK   + I F D E + +  QRI   VGRR+DE+SP+ DARL DGSRVNVI  PLA
Sbjct: 150 VERFGKLELSPITFIDEEHVFNTAQRIAAAVGRRIDEASPMVDARLPDGSRVNVITYPLA 209

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           +DG T++IRKF +  L+L+ L     ++   A +L    + R NV++SGGTG+GKTTLLN
Sbjct: 210 IDGTTISIRKFMRRNLSLEMLAERRCMSYAMADVLNKAMQARVNVIVSGGTGAGKTTLLN 269

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L++ I   +RI+T ED AELQLQQ HVVRLETRP + EG G +  RDL++N LRMRP+R
Sbjct: 270 ALSQKIGSTDRIITIEDAAELQLQQEHVVRLETRPVSAEGTGRVDQRDLMRNALRMRPDR 329

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           IILGEVRG E  D+LQAMNTGHDGS+ T+HAN +R++  R+E M+ M    LP   +R  
Sbjct: 330 IILGEVRGGESFDMLQAMNTGHDGSLCTVHANTSRDAIQRLENMVMMANMQLPLMAIRRQ 389

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHIS 448
           I S++ +IVQ +R+RDG RR+ +I E+ GME  VI  QDL  + + G D  G L G+++ 
Sbjct: 390 IASAVHLIVQIERMRDGMRRVVSITEVCGMENEVIQLQDLFSFNIQGMDGQGLLTGEYVQ 449

Query: 449 TGVSRPRFWNRAAQ 462
             + RP+F++  A 
Sbjct: 450 H-IQRPQFYSDKAH 462


>gi|87308906|ref|ZP_01091044.1| probable secretion atpase protein [Blastopirellula marina DSM 3645]
 gi|87288249|gb|EAQ80145.1| probable secretion atpase protein [Blastopirellula marina DSM 3645]
          Length = 482

 Score =  359 bits (922), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 180/411 (43%), Positives = 274/411 (66%), Gaps = 6/411 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           +  +K+++   +++ +D+  ++  + ++ R +I  L ++    K + +  + +  L ++L
Sbjct: 20  FQRLKTSLHEEMVDSLDLGAVTNRNEEAIRGDIRNLSSKYCQRKNLKLDAETRERLEKEL 79

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             ++ G GP++PL+    I+DI+VNG+ +V+IE  G+   T + F D+  +L + QR+V 
Sbjct: 80  DYELFGLGPIEPLMHDPTISDILVNGAREVYIERFGQLELTDVIFADDAHVLRIIQRVVG 139

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DE SP+ DARL DGSRVN ++ PLAL GP L+IR+F  + L L +L++  +++ 
Sbjct: 140 RVGRRIDEVSPMVDARLPDGSRVNAVVAPLALGGPKLSIRRFGVEHLHLANLIATDSLSQ 199

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A  LQ     R + LISGGTG+GKTTLLN L+ YI  DERIVT ED+AEL LQ PHV+
Sbjct: 200 EMADFLQAAVASRISFLISGGTGAGKTTLLNALSTYIPHDERIVTIEDSAELLLQHPHVL 259

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            +ETRP N EG G +T RDLV+N LRMRP+RII+GEVRG E LD+LQAMNTGH+GS+ TI
Sbjct: 260 GMETRPSNAEGAGAVTQRDLVRNSLRMRPDRIIVGEVRGAEALDMLQAMNTGHEGSLTTI 319

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI-- 415
           HAN++R++  R+E M+AM GF LP +++R+ I + + ++V   RL+ G RR+T I EI  
Sbjct: 320 HANDSRDALARLEMMVAMTGFELPVKVIRQYIATGIKMVVHVSRLKGGVRRVTRIAEIRE 379

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTG---VSRPRFWNRAAQY 463
           V   G+ ++  D+  +   G DE G+  G+  +TG   + R RF N   ++
Sbjct: 380 VNENGDYVL-DDIFGFRQEGLDEQGRAKGRFYATGYWALCRERFANAGVEF 429


>gi|262171238|ref|ZP_06038916.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus MB-451]
 gi|261892314|gb|EEY38300.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio mimicus MB-451]
          Length = 457

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 254/347 (73%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           MS + +  + + + +++ G GPL+PL+    ++DI+VNG   +F+E  GK  +T   F D
Sbjct: 86  MSSEGRKRVIKQIEDEVFGLGPLEPLLHDKTVSDILVNGPKNIFVERRGKLEKTPYTFLD 145

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           +  L ++  RIV+QVGRR+DE+SP+ DARLLDGSRVN IIPPLALDG +++IR+F  DKL
Sbjct: 146 DRHLRNIIDRIVSQVGRRIDEASPMVDARLLDGSRVNAIIPPLALDGASVSIRRFAVDKL 205

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
           T+D+++ + +++ + A+ ++   +   N+LI+GGTGSGKTT LN  + +I  D+RI+T E
Sbjct: 206 TMDNMLGYNSLSPQMAKFVEAAVQGELNILIAGGTGSGKTTTLNIFSGFIPSDDRIITIE 265

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D+AELQLQQPHVVRLETRPPN+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L 
Sbjct: 266 DSAELQLQQPHVVRLETRPPNLEGKGEITQRDLVKNALRMRPDRIVLGEVRGAEAVDMLA 325

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  D
Sbjct: 326 AMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNISTKNLRAQIASAIHLVVQMERQED 385

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           G RR+ +I EI GMEG +I   ++  ++  G D  G +IG + +TGV
Sbjct: 386 GKRRMVSIQEINGMEGEIITMSEIFHFKRQGVDAEGNIIGFYTATGV 432


>gi|254506769|ref|ZP_05118909.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus 16]
 gi|219550350|gb|EED27335.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus 16]
          Length = 489

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 289/424 (68%), Gaps = 1/424 (0%)

Query: 29  SSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARD 88
           S+++ K+  +    + +  +G+   +     EVK      L+E +D+  L+  + + A++
Sbjct: 41  SASLLKEQKKKEQAANDKAVGDARKQLEQEQEVKHYYHQRLLETLDLGLLASLEPERAKN 100

Query: 89  EIATLMNEIVSVKKI-TMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKV 147
           ++   + ++++  +   +S + +  + + + +++ G GPL+PL+    ++DI+VNG   V
Sbjct: 101 DLHDAIVQLMADDQTHALSAEGRKRVIQQIEDEVFGLGPLEPLLHDATVSDILVNGPKHV 160

Query: 148 FIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPL 207
           F+E  GK  +T   F D   L ++  RIV+QVGRR+DE+SP+ DARL DGSRVN IIPPL
Sbjct: 161 FVERRGKLQQTPYTFLDERHLRNIIDRIVSQVGRRIDEASPMVDARLADGSRVNAIIPPL 220

Query: 208 ALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLL 267
           ALDG +++IR+F  +KL +D+L++F +++ + A+ ++   +   NVLISGGTGSGKTT L
Sbjct: 221 ALDGSSVSIRRFAVEKLNMDNLLAFNSLSPQMAQFVEAAVQGALNVLISGGTGSGKTTTL 280

Query: 268 NCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPE 327
           N  + +I  D+RIVT ED+AELQLQQ HVVRLETRP N+EG+GEIT RDLVKN LRMRP+
Sbjct: 281 NIFSNFIPHDDRIVTIEDSAELQLQQTHVVRLETRPANLEGKGEITQRDLVKNSLRMRPD 340

Query: 328 RIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVRE 387
           RI+LGEVRG E +D+L AMNTGHDGS+ TIHAN  R++  R+E M AM G+ + ++ +R 
Sbjct: 341 RIVLGEVRGAEAVDMLAAMNTGHDGSLATIHANTPRDALSRVENMFAMAGWNMSAKNLRS 400

Query: 388 IITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHI 447
            I S++ ++VQ +R  DG RR+ +ICEI GMEG +I   ++ K+   G DE G ++G + 
Sbjct: 401 QIASAIHLVVQMERQEDGKRRMVSICEINGMEGEIITMSEIFKFHRQGMDEEGNVLGYYT 460

Query: 448 STGV 451
           +TGV
Sbjct: 461 ATGV 464


>gi|260881320|ref|ZP_05404118.2| pilus assembly protein CpaF [Mitsuokella multacida DSM 20544]
 gi|260849098|gb|EEX69105.1| pilus assembly protein CpaF [Mitsuokella multacida DSM 20544]
          Length = 468

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 271/407 (66%), Gaps = 6/407 (1%)

Query: 58  YYEVKSTIFTTLI-EMIDITQLSQYDSQSARDEIATLMNE----IVSVKKITMSLDEQLD 112
           Y EVK  I   ++ EM    QL          ++ TL+ +    ++      +   E+  
Sbjct: 35  YQEVKQRIHQRIVDEMTPEEQLMLTSVHQDPHQVETLITDYCQRVLDENPFAIPQGEKPR 94

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           L  D+ +++LG GP++ L   D I +IMVNG  +VF+E  GK   T   F D   L+++ 
Sbjct: 95  LIADIRDEVLGLGPIEALRKDDAITEIMVNGPRQVFVERMGKLELTDAKFHDTAHLMNII 154

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RI+  +GRRVDESSP+ DARL DGSRVN+IIPPL+L GP LTIRKF K  L++D+L+SF
Sbjct: 155 ERILTPLGRRVDESSPLVDARLEDGSRVNIIIPPLSLVGPCLTIRKFSKTPLSVDNLISF 214

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G +  + A  L+   + R N+L+SGGTGSGKTT LN ++ +I + ERIVT ED AEL+LQ
Sbjct: 215 GTMDEKMATFLRACVKARINILVSGGTGSGKTTTLNVISSFIPEGERIVTIEDAAELRLQ 274

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           Q HVV LE RP N+EG+G IT+RDLV+N LRMRP+RII+GEVR  E LD+LQAMNTGHDG
Sbjct: 275 QQHVVTLEARPANLEGKGAITIRDLVRNALRMRPDRIIVGEVRTGEALDMLQAMNTGHDG 334

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           S+ T HAN+ R+   R+E M+ M G  LP + +RE I+S++D+I+   RLRDGSR+IT I
Sbjct: 335 SLTTAHANSPRDVLSRLETMVMMSGLELPERAIREQISSAIDLIIHQARLRDGSRKITYI 394

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
            E+  MEG  I TQD+ +++  G D  GK++G  + TG+ +P F  +
Sbjct: 395 TEVQKMEGTTITTQDIFRFDQTGFDSNGKILGHFVPTGL-QPSFLEK 440


>gi|154250528|ref|YP_001411352.1| type II secretion system protein E [Parvibaculum lavamentivorans
           DS-1]
 gi|154154478|gb|ABS61695.1| type II secretion system protein E [Parvibaculum lavamentivorans
           DS-1]
          Length = 408

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 187/392 (47%), Positives = 257/392 (65%), Gaps = 8/392 (2%)

Query: 31  NIQKQNLQSSSPSAEGEIGNFVNRTPHYYEVKSTIFTTLIEMIDITQLS--QYDSQSARD 88
           ++Q   L + SP ++  I +       Y E+K  +F   +E +D   +        + +D
Sbjct: 3   SMQPYTLGTDSPPSDIGISD------RYQEIKFRVFDLTLEYLDQQGVEGEAISLTALQD 56

Query: 89  EIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVF 148
           EIA  +  ++  + I +++ E+  L ED+ N+I+G+GPL+PL+    I DI+VNG  +++
Sbjct: 57  EIARAIAVVLMSRGIALNMRERAQLIEDVQNEIVGFGPLEPLLRDPTIDDIIVNGPARIY 116

Query: 149 IEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLA 208
           +E +G+       FRD   L++V QRIV+ +GRRVDE +P  D RL DGSRVNVIIPP+A
Sbjct: 117 VERHGELELVQTRFRDTTHLMNVIQRIVSPIGRRVDEGTPYVDGRLPDGSRVNVIIPPVA 176

Query: 209 LDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLN 268
           LDGP L++RKFK   LT D LV    +T E  + L    R + N+LI GGTGSGKTTLLN
Sbjct: 177 LDGPILSVRKFKHIPLTGDDLVRSNMMTPEMLKFLSGAVRGKRNILICGGTGSGKTTLLN 236

Query: 269 CLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPER 328
            L+ YI   ER+VT ED AELQLQQ HVVRLETRP + +G  E+T RDL++N LRMRP+R
Sbjct: 237 VLSSYIGIKERLVTIEDAAELQLQQSHVVRLETRPSSPDGANEVTARDLLRNVLRMRPDR 296

Query: 329 IILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREI 388
           IILGEVR  E +++LQAM TGHDGSM T+HAN  R++  R+E +I + GF+   Q VR  
Sbjct: 297 IILGEVRSSEAIEMLQAMGTGHDGSMATLHANGPRDALERLEMLIGLHGFSADLQAVRRF 356

Query: 389 ITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           I  ++ ++VQT R  DG RRI +ICE+ GMEG
Sbjct: 357 IAGAIHIVVQTARQSDGKRRIVSICEVTGMEG 388


>gi|148976658|ref|ZP_01813345.1| Flp pilus assembly protein TadA [Vibrionales bacterium SWAT-3]
 gi|145964009|gb|EDK29267.1| Flp pilus assembly protein TadA [Vibrionales bacterium SWAT-3]
          Length = 483

 Score =  358 bits (920), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 173/333 (51%), Positives = 249/333 (74%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+A   ++DI+VNG   VF+E  GK  +T   F D+  L ++  RIV+Q
Sbjct: 126 DEVFGLGPLEPLLADKTVSDILVNGPKNVFVERGGKLEKTPYTFLDDRHLRNIIDRIVSQ 185

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSRVN IIPPLALDGP+++IR+F  D LT+D+L+ + + + +
Sbjct: 186 VGRRIDEASPMVDARLADGSRVNAIIPPLALDGPSVSIRRFAVDSLTMDNLLQYKSASPQ 245

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   +   N+LISGGTGSGKTT LN  + +I +D+RI+T ED+AELQLQQPHV+R
Sbjct: 246 MAKFVEAAVKGELNILISGGTGSGKTTTLNIFSGFIPRDQRIITIEDSAELQLQQPHVIR 305

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEI+ R+LVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 306 LETRPANLEGKGEISQRELVKNTLRMRPDRIVVGEVRGSEAVDMLAAMNTGHDGSLATIH 365

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S++ ++VQ +R  DG RR+ +I EI GM
Sbjct: 366 ANTPRDALSRVENMFSMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSIQEINGM 425

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG VI   ++ +++  G DE+G ++G + +TGV
Sbjct: 426 EGEVITMSEIFRFQRQGVDESGNILGYYTATGV 458


>gi|301165543|emb|CBW25114.1| putative pilus assembly-related protein [Bacteriovorax marinus SJ]
          Length = 744

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 181/405 (44%), Positives = 276/405 (68%), Gaps = 7/405 (1%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSA---RDEIATLMNEIVS---VKKITMSLDEQL 111
           + E+KS I   L++ +D+      D ++A   R++   ++ E++     K +  + ++  
Sbjct: 277 WTELKSRIHKALVDEMDLKNSDDNDPKAAIIMREQTKKMVVELLGKEDTKSVFQTREDMN 336

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            + +++ ++ LG GPL+ L+A  + ++IMV G +K+F E +GK  ++ I F ++ Q+L+V
Sbjct: 337 RIVKEILDEALGLGPLEDLLADKECSEIMVVGPDKIFYEKSGKVKKSDITFTNDRQVLNV 396

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV  +GRR+DE +P  DARL DGSRV+ IIPP ALDG  +TIRKF ++ +T    + 
Sbjct: 397 IERIVAPIGRRIDEKTPYVDARLKDGSRVHAIIPPSALDGCCITIRKFPEEVVTYKDYIK 456

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           +G++T   A  L+I      N+++SGGTGSGKTTL+N L  +I  +ERI+TCED+AEL  
Sbjct: 457 WGSLTQNMADFLRIAVEGHRNIVVSGGTGSGKTTLINILGGFIPANERIITCEDSAELNF 516

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            Q HVVRLETRPP++EG+GEI +R LVK  LRMRPERI++GE RG E LD+LQAM TGHD
Sbjct: 517 PQDHVVRLETRPPSLEGDGEIDIRCLVKQTLRMRPERIVVGECRGGETLDMLQAMGTGHD 576

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSM T+H+NN RE  GR+E ++   G  L  + +RE+I +S+ +I+Q +RL DGSR++T+
Sbjct: 577 GSMTTVHSNNPRECIGRLETLVQYAGAGLSPKAIREMIANSVHMIIQQKRLDDGSRKMTH 636

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRF 456
           I EI G++G+V+  QD+  ++    D+ GK+IG+  +TG   P+F
Sbjct: 637 ISEIGGIQGDVVTLQDIFLFQQRDIDKNGKIIGEFQATGFI-PKF 680


>gi|187251611|ref|YP_001876093.1| TadA subunit [Elusimicrobium minutum Pei191]
 gi|186971771|gb|ACC98756.1| TadA subunit [Elusimicrobium minutum Pei191]
          Length = 742

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 189/410 (46%), Positives = 280/410 (68%), Gaps = 6/410 (1%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQL---SQYDSQSARDEIATLMNEIVSVK-KITMSLDE 109
           R   + E+K  +   +I+ +++ ++    + +S+  R  +  ++ EI+  +  +  S ++
Sbjct: 308 RMSFWDELKQRVHKEVIKALELERIVISDESNSEQTRKRVGEIIEEILQKQPNLQFSREQ 367

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
           ++    +L ++ILG GPL+ L+    + +IMVN  +K+FIE  GK   T   FR+N+Q++
Sbjct: 368 RVRFATELLDEILGLGPLEGLMRDPSVTEIMVNSFDKIFIEQKGKLTLTKYRFRNNDQVV 427

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
            V +RIV  +GRR+DES P+ DARL DGSRVN II PLA+ GP+LTIR+F +     +  
Sbjct: 428 QVIKRIVAPLGRRIDESVPLVDARLKDGSRVNAIIAPLAVSGPSLTIRRFSQKPFGPEDY 487

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
             FG ++ E    L+   +IR N++ISGGTG+GKTT LN L+ YI  DERI+T EDTAEL
Sbjct: 488 YRFGTISRECMDFLKECVKIRKNIIISGGTGTGKTTFLNALSTYIPSDERIITVEDTAEL 547

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
           +LQQ H + LE+RP NIEG+GEIT++DLVKNCLRMRP+RI++GE RG E LD+LQAMNTG
Sbjct: 548 RLQQVHWISLESRPANIEGKGEITIQDLVKNCLRMRPDRIVVGECRGKEALDMLQAMNTG 607

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGS+ TIHANN ++   R+EAM  MG   LP   +RE+++S++++IVQ  R  DGSR++
Sbjct: 608 HDGSLATIHANNPKDGLTRLEAMCMMGSADLPIWAIREMVSSAVNMIVQLSRFSDGSRKV 667

Query: 410 TNICEIVGMEGNVIITQDLLKY-EVMGEDETGKLIGQHISTGVSRPRFWN 458
           T I EI+G +  +I T DL +Y +   ++ETGK+ G   +TG ++P F++
Sbjct: 668 TYITEILGQKDGIIHTNDLFRYRQTSIDEETGKVQGHFAATG-NKPSFYD 716


>gi|116626437|ref|YP_828593.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229599|gb|ABJ88308.1| type II secretion system protein E [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 445

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 278/402 (69%), Gaps = 1/402 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y+E+KS I   LI ++++ + S       R EI  ++  ++  +++ M+  EQ  + E++
Sbjct: 24  YFELKSQIHRKLIGVLNLERASSIPKDRIRAEIGRVVERLLDEERVPMTTAEQSKIVEEV 83

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++LG GPL+ L+    I+DI+VN  NKVFIE NGK  ET + F+D+  LL + ++IV+
Sbjct: 84  LDEVLGLGPLETLLKEPTISDILVNRYNKVFIERNGKLSETSVRFKDDAHLLHIIEKIVS 143

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           QVGRR+DE+ PI DARL DGSRVN IIPPLALDGP L+IR+F +  +T D +V +  +T 
Sbjct: 144 QVGRRIDEAQPIVDARLQDGSRVNAIIPPLALDGPCLSIRRFGRHVITQDEMVQYKTLTP 203

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
              R L    + +  VLISGGTGSGKTT LN L+R+I ++ERI+T EDTAELQLQQ HV+
Sbjct: 204 GMLRFLSACVQCKATVLISGGTGSGKTTTLNALSRFIPEEERIITIEDTAELQLQQRHVI 263

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           + ETRPPN+  EG I  R L++  LRMRP+RII+GE RG E LD+LQAMNTG +GSM T+
Sbjct: 264 KFETRPPNLNKEGGINQRILLRTALRMRPDRIIVGECRGAEALDMLQAMNTGVEGSMSTV 323

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN  +++F R+E M  M    +P++++   + S++ ++VQ  RL+DG+R++ +I E++G
Sbjct: 324 HANTPKDAFSRLETMCMMADLEIPTRVILSQLASAIKLVVQVSRLQDGTRKVLSISEVLG 383

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNR 459
           +  + +  Q++  +E +G  +TGK+ G+  +TGV+ P+  +R
Sbjct: 384 VLDDKVHLQEIFTFERIGVTDTGKVQGRFKATGVT-PKILDR 424


>gi|108762982|ref|YP_631310.1| type II/IV secretion system protein [Myxococcus xanthus DK 1622]
 gi|108466862|gb|ABF92047.1| type II/IV secretion system protein [Myxococcus xanthus DK 1622]
          Length = 595

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 196/424 (46%), Positives = 281/424 (66%), Gaps = 10/424 (2%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQY----DSQSARDEIATLMNEIVSVKKITMSLDE 109
           R   Y  ++  I   LIE +D+ ++       D    R E A  + +I+   +    L E
Sbjct: 170 RQERYTRLQKEIHDRLIEYLDLRRMDMDRLGDDELWRRTEKA--IRDIIDQMEADGELPE 227

Query: 110 QLD---LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNE 166
            +D   L  D+ N+ LG GPL+  +A DDI++IMVN +N+++IE  GK   +   F  N+
Sbjct: 228 DVDREELLTDVINEALGLGPLEAFLASDDISEIMVNHANQIYIERKGKLTLSEKTFSSNQ 287

Query: 167 QLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTL 226
            +L V +RIV  +GRR+DESSP+ DARL DGSRVN IIPPLAL GP +TIRKFKKD L +
Sbjct: 288 AVLGVIERIVAPIGRRIDESSPLVDARLKDGSRVNAIIPPLALKGPCITIRKFKKDSLKI 347

Query: 227 DHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDT 286
             L+ +  VTA+ A  L++  + R N++ISGGTGSGKTT LN ++ +I + ERI+T ED 
Sbjct: 348 ADLIKYKTVTAQMAEFLEMCVKARRNIVISGGTGSGKTTTLNIISSFIPEGERIITVEDA 407

Query: 287 AELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAM 346
           AELQL Q H V+LE+RPPN+EG+G IT+R+LVKNCLRMRP+RI++GE R  E LD+LQAM
Sbjct: 408 AELQLPQDHWVQLESRPPNLEGKGAITIRELVKNCLRMRPDRIVVGECRSGETLDMLQAM 467

Query: 347 NTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGS 406
           NTGHDGS+ T+HAN  R++  R+E M+ M G  LP + +RE I S++ +IVQ  R  DG+
Sbjct: 468 NTGHDGSLTTLHANTPRDAIARLETMVLMSGMDLPVKAIREQIASAVHMIVQQTRFSDGT 527

Query: 407 RRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEE 466
           R+I  I E+ GME +++  QD+  ++  G  E  K+ G+++++G   P+F++   + G  
Sbjct: 528 RKICYITEVSGMEVDIVTLQDIFYFKQDGFTEDHKVRGRYVASGFV-PKFYDELQRKGIP 586

Query: 467 KNLA 470
            N++
Sbjct: 587 VNMS 590


>gi|320016747|gb|ADW00319.1| Type II/IV secretion system ATP hydrolaseTadA/VirB11/CpaF, TadA
           subfamily [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 428

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 253/367 (68%), Gaps = 8/367 (2%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + E + ++I G+GPL+ L+  D I+DIMVNG  ++FIE  G    T   F +N QL  + 
Sbjct: 61  IIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLKLTDRRFVNNTQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++ +V RR+DE  P+ DARL+DGSR+NV I P+ALDG  L+IRKF K+K  L+ LV  
Sbjct: 121 KRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALSIRKFSKNKRRLEDLVDM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           GA++++ A  L I    R N++ SGGTGSGKTTLLN L++YI +DER++T ED AEL L+
Sbjct: 181 GAMSSDMANFLIIAASCRVNIITSGGTGSGKTTLLNALSKYISEDERVITLEDAAELNLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR+I NI
Sbjct: 301 SMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASAINLIVQVSRMNDGSRKIRNI 360

Query: 413 CEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGVSRPRFWNRAAQY--GEEKNL 469
            EI+GMEG  ++ QD+  ++     D+ G++ G+ I+ G+     +NR++     +  NL
Sbjct: 361 SEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHGL-----FNRSSVRINADIHNL 415

Query: 470 AEVLQSL 476
           A  L S+
Sbjct: 416 ANELNSV 422


>gi|323499918|ref|ZP_08104877.1| Flp pilus assembly protein [Vibrio sinaloensis DSM 21326]
 gi|323315159|gb|EGA68211.1| Flp pilus assembly protein [Vibrio sinaloensis DSM 21326]
          Length = 489

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 196/451 (43%), Positives = 300/451 (66%), Gaps = 6/451 (1%)

Query: 7   KKLMGSVKREDNNPLPQEV-----VVSSSNIQKQNLQSSSPSAEGEIGNFVNRTPHYYEV 61
           KK++ + +RE  +    EV      +++SN  K+  +    +++  + +   +     EV
Sbjct: 14  KKVIEADQREQQDASGLEVGGESSALTASNALKEKKKQEQEASDKAVDDARKQLKQEQEV 73

Query: 62  KSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKI-TMSLDEQLDLFEDLCND 120
           K      L+E +D+  L+  + + A++++   + ++++  +   +S + +  + + + ++
Sbjct: 74  KHYYHQRLLETLDLGLLASLEKERAKNDLHDAIVQLMADDQTHALSAEGRKRVIQQIEDE 133

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           + G GPL+PL+    ++DI+VNG   VF+E  GK  +T   F D   L ++  RIV+QVG
Sbjct: 134 VFGLGPLEPLLNDATVSDILVNGPKHVFVERRGKLQQTPYTFLDERHLRNIIDRIVSQVG 193

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DE+SP+ DARL DGSRVN IIPPLALDG +++IR+F  +KL +D+L++F +++ + A
Sbjct: 194 RRIDEASPMVDARLTDGSRVNAIIPPLALDGSSVSIRRFAVEKLNMDNLLAFNSLSPQMA 253

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           + ++   +   NVLISGGTGSGKTT LN  + +I  D+RIVT ED+AELQLQQ HVVRLE
Sbjct: 254 QFVEAAVQGALNVLISGGTGSGKTTTLNIFSNFIPADDRIVTIEDSAELQLQQTHVVRLE 313

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP N+EG+GEIT RDLVKN LRMRP+RI+LGEVRG E +D+L AMNTGHDGS+ TIHAN
Sbjct: 314 TRPANLEGKGEITQRDLVKNSLRMRPDRIVLGEVRGAEAVDMLAAMNTGHDGSLATIHAN 373

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
             R++  R+E M AM G+ + ++ +R  I S++ ++VQ +R  DG RR+ +ICEI GMEG
Sbjct: 374 TPRDALSRVENMFAMAGWNMSAKNLRSQIASAIHLVVQMERQEDGKRRMVSICEINGMEG 433

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
            +I   ++ K+   G DE G + G + +TGV
Sbjct: 434 EIITMSEIFKFHRQGMDEEGNVQGFYTATGV 464


>gi|238789150|ref|ZP_04632938.1| Type II secretion protein [Yersinia frederiksenii ATCC 33641]
 gi|238722682|gb|EEQ14334.1| Type II secretion protein [Yersinia frederiksenii ATCC 33641]
          Length = 427

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 178/370 (48%), Positives = 256/370 (69%), Gaps = 6/370 (1%)

Query: 109 EQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQL 168
           +Q  +   + ++I G+GPL+ L+  D I+DIMVNG +K+FIE  G    T   F  N QL
Sbjct: 57  DQKKIISMIADEITGFGPLRELMEDDSISDIMVNGPDKIFIERYGLISLTDRRFISNTQL 116

Query: 169 LSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDH 228
             + +R++ +V RR+DE  P+ DARL+DGSR+N+ + P+ALDG  L+IRKF  +K  L+ 
Sbjct: 117 TDIAKRLMQKVNRRIDEGRPLADARLVDGSRINIAMSPIALDGTALSIRKFSNNKRKLED 176

Query: 229 LVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAE 288
           LV  GA++++ A  L I    R N++ISGGTGSGKTTLLN L+ YI K+ER++T ED AE
Sbjct: 177 LVDMGAMSSDIANFLIIAASCRVNIIISGGTGSGKTTLLNALSMYISKNERVITLEDAAE 236

Query: 289 LQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNT 348
           L L+QPHVVR+ETR   +E  G+I+MRDLV N LRMRP+RII+GE RG E  ++LQAMNT
Sbjct: 237 LNLEQPHVVRMETRLAGLENTGQISMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNT 296

Query: 349 GHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRR 408
           GH+GSM T+HAN+ R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DG+R+
Sbjct: 297 GHNGSMSTLHANSPRDAIARLESMIMMGPVNMPLFTIRRNIASAINIIVQVSRMNDGTRK 356

Query: 409 ITNICEIVGMEGNVIITQDLLKYEVMG-EDETGKLIGQHISTG-VSRPRFWNRAAQYGEE 466
           I +I EI+GMEG+ ++ QD+  ++  G  D+ GK+ G+ I+ G +SR      A+ Y   
Sbjct: 357 IQHISEIMGMEGDNVVLQDIFSFKPSGIRDDQGKIQGEFINHGLLSRSSVKINASIY--- 413

Query: 467 KNLAEVLQSL 476
            NL++ L S+
Sbjct: 414 -NLSDELNSI 422


>gi|86147461|ref|ZP_01065773.1| Flp pilus assembly protein TadA [Vibrio sp. MED222]
 gi|85834754|gb|EAQ52900.1| Flp pilus assembly protein TadA [Vibrio sp. MED222]
          Length = 483

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 173/333 (51%), Positives = 247/333 (74%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+A   ++DI+VNG   VF+E  GK  +T   F D+  L ++  RIV+Q
Sbjct: 126 DEVFGLGPLEPLLADKTVSDILVNGPKSVFVERGGKLEKTPYTFLDDRHLRNIIDRIVSQ 185

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSRVN IIPPLALDGP+++IR+F  D LT+D+L+ + + + +
Sbjct: 186 VGRRIDEASPMVDARLADGSRVNAIIPPLALDGPSVSIRRFAVDSLTMDNLLEYKSASPQ 245

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ ++   +   N+LISGGTGSGKTT LN  + +I +D+RI+T ED+AELQLQQPHV+R
Sbjct: 246 MAKFVEAAVKGELNILISGGTGSGKTTTLNIFSGFIPRDQRIITIEDSAELQLQQPHVIR 305

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP N+EG+GEI+ R+LVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 306 LETRPANLEGKGEISQRELVKNTLRMRPDRIVVGEVRGSEAVDMLAAMNTGHDGSLATIH 365

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S++ ++VQ +R  DG RR+ +I EI GM
Sbjct: 366 ANTPRDALSRVENMFSMAGWNISTKNLRAQIASAIHLVVQMERQEDGKRRMVSIQEINGM 425

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG VI   ++  ++  G DE G ++G + +TGV
Sbjct: 426 EGEVITMSEIFHFQRQGVDEHGNILGYYTATGV 458


>gi|123443823|ref|YP_001007794.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090784|emb|CAL13666.1| putative tight adherance operon protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 424

 Score =  356 bits (914), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 261/387 (67%), Gaps = 5/387 (1%)

Query: 69  LIEMIDITQLSQY---DSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYG 125
           ++  IDI Q+ QY   D     + ++  ++E+ +     ++  +Q  +   + ++I G+G
Sbjct: 11  MLASIDIDQV-QYLVDDYSKLSELLSQTLDELFNNNDYKLTTQDQKKIITMIADEITGFG 69

Query: 126 PLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDE 185
           PL+ L+  D I+DIMVNG  K+FIE  G    T   F +N QL  + +R++ +  RR+DE
Sbjct: 70  PLRELMEDDSISDIMVNGPEKIFIERFGMITLTSRRFINNAQLTDIAKRLMQRANRRIDE 129

Query: 186 SSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQI 245
             P+ DARL+DGSR+NV I P+ALDG  L+IRKF  +K  L+ LV  GA++++ A  L I
Sbjct: 130 GRPLADARLIDGSRINVAISPIALDGTVLSIRKFSNNKRKLEDLVEMGAMSSDMANFLII 189

Query: 246 IGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPN 305
               R N++ISGGTGSGKTTLLN L+ YI ++ER++T ED AEL L+QPHVVR+ETR   
Sbjct: 190 AASCRVNIIISGGTGSGKTTLLNALSMYISENERVITLEDAAELNLEQPHVVRMETRLAG 249

Query: 306 IEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARES 365
           +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+GSM T+HAN  R++
Sbjct: 250 LENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNGSMSTLHANTPRDA 309

Query: 366 FGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIIT 425
             R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR++++I EI+GMEG+ +I 
Sbjct: 310 VARLESMIMMGPVNMPILTIRRNIASAINLIVQVSRMNDGSRKLSHISEIMGMEGDNVIL 369

Query: 426 QDLLKYEVMGE-DETGKLIGQHISTGV 451
           QD+  ++   E    GK+ G+ I+ G+
Sbjct: 370 QDIFSFKPAKERGSEGKIQGEFINHGL 396


>gi|318604219|emb|CBY25717.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA
           subfamily [Yersinia enterocolitica subsp. palearctica
           Y11]
          Length = 365

 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 241/336 (71%), Gaps = 1/336 (0%)

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ++I G+GPL+ L+  D I+DIMVNG  K+FIE  G    T   F +NEQL  + +R++
Sbjct: 2   IADEITGFGPLRELMEDDSISDIMVNGPEKIFIERFGMITLTSRRFINNEQLTDIAKRLM 61

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
            +  RR+DE  P+ DARL+DGSR+NV I P+ALDG  L+IRKF  +K  L+ LV  GA++
Sbjct: 62  QRANRRIDEGRPLADARLIDGSRINVAISPIALDGTVLSIRKFSNNKRKLEDLVDMGAMS 121

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
           ++ A  L I    R NV+ISGGTGSGKTTLLN L+ YI ++ER++T ED AEL L+QPHV
Sbjct: 122 SDMANFLIIAASCRVNVIISGGTGSGKTTLLNALSMYISENERVITLEDAAELNLEQPHV 181

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+GSM T
Sbjct: 182 VRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNGSMST 241

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN  R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR++++I EI+
Sbjct: 242 LHANTPRDAVARLESMIMMGPVNMPILTIRRNIASAINLIVQVSRMNDGSRKLSHISEIM 301

Query: 417 GMEGNVIITQDLLKYEVMGE-DETGKLIGQHISTGV 451
           GMEG+ +I QD+  ++ + E  + GK+ G+ I+ G+
Sbjct: 302 GMEGDNVILQDIFSFKPVKERGQEGKIQGEFINHGL 337


>gi|327539550|gb|EGF26160.1| type II/IV secretion system protein, TadA subfamily protein
           [Rhodopirellula baltica WH47]
          Length = 458

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 264/428 (61%), Gaps = 1/428 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   + ++K+ I   LI  ID+           R+E+     ++  +    +S  E+  L
Sbjct: 24  RENRFQQLKAEIHEKLISGIDMAVSRSVKEDRLREELRRGAEQLSRMHSDLLSQAERQRL 83

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ++L ++ +G GPL+PL+    ++DI+VNG + V++E  G    T I FRDN+ L+ + +
Sbjct: 84  IDELVDETMGLGPLEPLMRDPSVSDILVNGPDCVYVERGGVLEPTPIKFRDNDHLVDIVR 143

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +I  +VGRR+DESSP+ DARLLDGSR+N +IPPLALDG  ++IR+F    +T   L+   
Sbjct: 144 KIAGRVGRRIDESSPMVDARLLDGSRLNAVIPPLALDGALVSIRRFSTKPITAKSLIETN 203

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           + T      L    + R N+LISGGTGSGKTTLLN L+ YI K+ERI T ED AEL+LQQ
Sbjct: 204 SATPMMLEFLAACVQARMNILISGGTGSGKTTLLNLLSAYIPKEERIATIEDAAELRLQQ 263

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHV R+ETR  N+EG G++T RDL+ N LRMRP+RII+GE RG E  D+LQAMNTGHDG 
Sbjct: 264 PHVARMETRTSNLEGRGQVTSRDLLCNALRMRPDRIIMGECRGAEAFDMLQAMNTGHDGG 323

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIH+N+ARE+  R+E +++M    LP   +   I S++ +IV   R+  G R+I  I 
Sbjct: 324 MSTIHSNDAREAIHRLEMLVSMAATDLPMWFIHRQIASAIHIIVHVTRMPGGERKIVQIS 383

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           E+ G+ G  +   DL  Y   G DE G+  G+  + G+  P+  +R  + G++   A   
Sbjct: 384 EVTGVNGETVNMHDLFIYRQTGVDEEGRTQGRFEAKGII-PQCLDRLGRAGKKFTPASFR 442

Query: 474 QSLEKQSR 481
           +++  + +
Sbjct: 443 ETITAEEK 450


>gi|186473165|ref|YP_001860507.1| FHA domain-containing protein [Burkholderia phymatum STM815]
 gi|184195497|gb|ACC73461.1| FHA domain containing protein [Burkholderia phymatum STM815]
          Length = 563

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 184/407 (45%), Positives = 265/407 (65%), Gaps = 4/407 (0%)

Query: 55  TPHYYEVKSTIFTTLIEMIDITQL--SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLD 112
           +P   +++  +   +I+ +D+ +L  S+      R  +   +++I++        D  L 
Sbjct: 140 SPEGIDLRKLLHMKVIDALDLRRLNVSRMADDELRATVGDALDDILARDASFRRSDIPLP 199

Query: 113 -LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            L   + ++I+G GPL+ LIA   I++IMVN  +++F+E  G+   + + F D   +L  
Sbjct: 200 TLKRSVFDEIIGLGPLEELIADPTISEIMVNRHDEIFVEQQGRLRRSPVIFTDERAVLGA 259

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RIV  +GRR+DESSP+ DARL DGSRVN +IPPLAL GP++T+RKF + KL    L+ 
Sbjct: 260 IERIVAPIGRRIDESSPMVDARLKDGSRVNAVIPPLALKGPSMTVRKFPQQKLRGYDLLG 319

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
           FG+++      L+     R N++ISGGTGSGKTTLLN L+ YI  +ERIVT ED AELQL
Sbjct: 320 FGSLSPAMLAFLRTAVEQRANIVISGGTGSGKTTLLNVLSDYIPDEERIVTVEDAAELQL 379

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
            QP++V LETRP N+EG+G +T+R+LV+NCLRMRP+RI++GE RG E LD+LQAMNTGHD
Sbjct: 380 SQPNLVALETRPANLEGKGAVTIRELVRNCLRMRPDRIVVGECRGGEALDMLQAMNTGHD 439

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GS+ T HAN+ R+   R+E M  M G  LP Q +RE + +++D+IVQ  R   GSRR+T+
Sbjct: 440 GSLTTAHANSPRDCIARLEVMTLMAGLDLPVQAIREQVCAAVDIIVQQTRFSCGSRRVTH 499

Query: 412 ICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWN 458
           I E+ G+E  VI  QD+  +   G  E GK+ GQ + T    P F+ 
Sbjct: 500 ITEVSGIESGVIQLQDIFVFREAGLGENGKIRGQFMPTSYI-PDFYQ 545


>gi|319941899|ref|ZP_08016220.1| flp pilus assembly protein [Sutterella wadsworthensis 3_1_45B]
 gi|319804552|gb|EFW01422.1| flp pilus assembly protein [Sutterella wadsworthensis 3_1_45B]
          Length = 424

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 185/414 (44%), Positives = 267/414 (64%), Gaps = 5/414 (1%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           V + + + ++E ID         +   +++A  +   V  +++ ++  EQ  L  ++ ND
Sbjct: 13  VYARLRSLIVERIDAEAALHMKPEELEEQVARTIANAVQTERLFLNGHEQRLLTREIVND 72

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
           ++  GP+Q  I   ++ D+++NG ++V +E  GK   T I FR+ E LL++ QRI + VG
Sbjct: 73  MIRLGPIQGAIDDPEVTDVLINGPDQVLVERRGKLELTSIRFRNAEHLLNLAQRITSAVG 132

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DESSP+ DARL DGSRVN+I PPL L+G  ++IRKF +  ++LD L + GA+T E A
Sbjct: 133 RRIDESSPMVDARLADGSRVNIIAPPLCLNGICISIRKFSRLVMSLDELAARGAMTGEIA 192

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
           + L+I  R R N+L+SGGTGSGKTT+LN L+++I +DERIVT ED AEL+L QP VVRLE
Sbjct: 193 QFLKIAARARLNILVSGGTGSGKTTMLNALSQHIARDERIVTIEDAAELRLDQPFVVRLE 252

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP ++EG+GE+T RDL+KN LRMRP+RI++GEVRG E  D+LQAMNTGHDGS+ TIHAN
Sbjct: 253 TRPASLEGKGEVTQRDLLKNALRMRPDRILVGEVRGVEAFDMLQAMNTGHDGSLSTIHAN 312

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME- 419
           +  ++  R+E M+ MG   + S ++R  + S+LD++VQ +R   G RRIT + EI   E 
Sbjct: 313 SPADALLRLENMLNMGANQMSSSLIRRQLASALDLLVQVERDGRGMRRITAVSEITADET 372

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVL 473
           G  +I      ++    D  G   GQ+       P F  +    GE     EVL
Sbjct: 373 GRDVIALPFFSFK-HAADGAG---GQYYRASPREPGFVEKLKVSGEYDQACEVL 422


>gi|238759124|ref|ZP_04620293.1| Type II secretion protein [Yersinia aldovae ATCC 35236]
 gi|238702672|gb|EEP95220.1| Type II secretion protein [Yersinia aldovae ATCC 35236]
          Length = 413

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/346 (49%), Positives = 243/346 (70%), Gaps = 6/346 (1%)

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ++I G+GPL+ L+  D I+DIMVNG  K+F+E  G    T   F +N QL  + +R++
Sbjct: 51  IADEITGFGPLRELMEDDSISDIMVNGPEKIFVERYGLLTLTKHRFINNSQLTDIAKRLM 110

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
            +V RR+DE  P+ DARL+DGSR+NV+I P+ LDG  L+IRKF  +K  L+ LV  GA++
Sbjct: 111 QRVNRRIDEGRPLADARLIDGSRINVVISPITLDGTVLSIRKFSTNKRKLEDLVDMGAMS 170

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
           ++ A  L I    R N++ISGGTGSGKTTLLN L++YI + ER++T ED AEL L+QPHV
Sbjct: 171 SDMANFLIIAACCRVNIIISGGTGSGKTTLLNALSKYISETERVITLEDAAELNLEQPHV 230

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           VR+ETR   +E  G+ITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+GSM T
Sbjct: 231 VRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNGSMST 290

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
           +HAN+ R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ DGSR++  I EI+
Sbjct: 291 LHANSPRDAIARLESMIMMGQVNMPLFTIRRNIASAINLIVQVSRMSDGSRKVRYISEIM 350

Query: 417 GMEGNVIITQDLLKYEVMGE-DETGKLIGQHISTGVSRPRFWNRAA 461
           GMEG  ++ QD+  +E   + DE GK+ G  I+ G+     +NR++
Sbjct: 351 GMEGENVVLQDIFSFEPSKQRDEQGKIQGDFINHGL-----FNRSS 391


>gi|156977406|ref|YP_001448312.1| flp pilus assembly ATPase CpaF [Vibrio harveyi ATCC BAA-1116]
 gi|156529000|gb|ABU74085.1| hypothetical protein VIBHAR_06193 [Vibrio harveyi ATCC BAA-1116]
          Length = 423

 Score =  354 bits (908), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 170/330 (51%), Positives = 241/330 (73%), Gaps = 4/330 (1%)

Query: 136 IADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLL 195
           I+DIMVNG N +F E +GK  ++ ++F + EQLL++ +RI ++VGRRVDE SP  DARL 
Sbjct: 82  ISDIMVNGPNNIFFERHGKVQKSEVSFVNEEQLLAIAKRIASRVGRRVDELSPTVDARLE 141

Query: 196 DGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLI 255
           DGSRVN++IPP+ALDG +++IRKF++  +  + L+ FG+++ + AR+L I  R R N+LI
Sbjct: 142 DGSRVNIVIPPIALDGTSISIRKFREQNIGFEDLIGFGSMSPDMARVLMIASRCRINILI 201

Query: 256 SGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMR 315
           SGGTGSGKTTLLN L++YI +DERI+T ED AEL+LQQP++VRLETR  ++E  G +  R
Sbjct: 202 SGGTGSGKTTLLNALSQYIAEDERIITIEDAAELRLQQPNLVRLETRTSSVEQTGAVNQR 261

Query: 316 DLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAM 375
           DLV N LRMRP+RIILGE RG E  ++LQAMNTGHDGSM T+HAN  R++  R+E+M+ M
Sbjct: 262 DLVINALRMRPDRIILGECRGSEAFEMLQAMNTGHDGSMSTLHANTPRDAIARVESMVMM 321

Query: 376 GGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL--LKYEV 433
                P   +R  I S++ +IVQ  RLRDGSR+IT+I EIVG+EG+ ++ +++   +Y+ 
Sbjct: 322 ANLNQPLDAIRRTIVSAVQMIVQVNRLRDGSRKITSISEIVGLEGDSVVMEEIYRFRYDD 381

Query: 434 MGEDETGKLIGQHISTGVSRPRFWNRAAQY 463
               ET K  G  +++G+ +     + AQ+
Sbjct: 382 THFGETVK--GDFVTSGIMQRSELVKKAQF 409


>gi|163801324|ref|ZP_02195223.1| putative Flp pilus assembly protein [Vibrio sp. AND4]
 gi|159174813|gb|EDP59613.1| putative Flp pilus assembly protein [Vibrio sp. AND4]
          Length = 413

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 174/365 (47%), Positives = 253/365 (69%), Gaps = 1/365 (0%)

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           ++E IDIT +   +     + I   +NE +S     ++  ++  L +++ +DI GYGPL+
Sbjct: 14  VLEHIDITDIQHENDDVKSNTIYATVNEFLSSYSAILTESDRQKLTKEIKDDIFGYGPLE 73

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVET-GINFRDNEQLLSVCQRIVNQVGRRVDESS 187
            L++ + I+DIMVN   + F+E NGK      + F++ +Q+L +  +IV+ +GRR+DESS
Sbjct: 74  DLLSDNTISDIMVNSLTETFVERNGKISRAYDVTFQNEDQVLRIATKIVSPIGRRIDESS 133

Query: 188 PICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIG 247
           P+ DARL DGSRVN+I+PP+ALDG +++IRKF++DKL +  LV + ++T E A  L ++ 
Sbjct: 134 PMVDARLPDGSRVNIIVPPVALDGCSISIRKFREDKLDIIDLVRYESMTEEMALYLSVMV 193

Query: 248 RIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIE 307
           R   N++ISGGTGSGKTTLLN  +  I +  R+VT ED AELQLQ  HVVRLE+RP   E
Sbjct: 194 RSAANIIISGGTGSGKTTLLNACSNEITEGHRVVTIEDAAELQLQHEHVVRLESRPATSE 253

Query: 308 GEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFG 367
             GE+++R LV N LRMRP+RII+GE RG E  ++LQAMNTGHDGSM TIH+NN +++  
Sbjct: 254 ESGEVSIRSLVINSLRMRPDRIIVGECRGDEAFEMLQAMNTGHDGSMSTIHSNNPKDALI 313

Query: 368 RMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQD 427
           RME+MI M    L  + +++ I+ ++D+I+QT RL DG R+IT+I E+   +G VI TQD
Sbjct: 314 RMESMIMMTASNLSPESIKKQISQAVDIIIQTSRLIDGRRKITHITEVGNFDGGVIATQD 373

Query: 428 LLKYE 432
           L  Y+
Sbjct: 374 LFVYD 378


>gi|238750900|ref|ZP_04612397.1| Type II secretion protein [Yersinia rohdei ATCC 43380]
 gi|238710814|gb|EEQ03035.1| Type II secretion protein [Yersinia rohdei ATCC 43380]
          Length = 428

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/376 (45%), Positives = 253/376 (67%), Gaps = 2/376 (0%)

Query: 105 MSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRD 164
           ++  +Q  +   + ++I G+GPL+ L+A D I+DIMVNG  K+F+E  G    T   F +
Sbjct: 53  LTTQDQKKIVSMIADEITGFGPLRELMADDSISDIMVNGPEKIFVERFGLITLTDRRFIN 112

Query: 165 NEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKL 224
           N QL  + +R++ +V RR+DE  P+ DARL+DGSR+N+ + P+ALDG  L+IRKF  +K 
Sbjct: 113 NTQLTEIAKRLMQRVNRRIDEGRPLADARLIDGSRINIALSPIALDGTALSIRKFSNNKR 172

Query: 225 TLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCE 284
            L+ LV  GA++++ A  L I    R N++ISGGTGSGKTTLLN L++YI K+ER++T E
Sbjct: 173 KLEDLVDMGAMSSDMANFLIISASCRVNIIISGGTGSGKTTLLNALSKYIAKNERVITLE 232

Query: 285 DTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQ 344
           D AEL L+QPHVVR+ETR   +E  G+I+MRDLV N LRMRP+RII+GE RG E  ++LQ
Sbjct: 233 DAAELNLEQPHVVRMETRLAGLENTGQISMRDLVINSLRMRPDRIIIGECRGEETFEMLQ 292

Query: 345 AMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRD 404
           AMNTGH GSM T+HAN+ R++  R+E+MI MG   +P   +R  I S++++IVQ  R+ D
Sbjct: 293 AMNTGHSGSMSTLHANSPRDAVARLESMIMMGPVNMPLFTIRRNIASAINLIVQVSRMND 352

Query: 405 GSRRITNICEIVGMEGNVIITQDLLKYE-VMGEDETGKLIGQHISTGV-SRPRFWNRAAQ 462
           G+R++ +I EI+GMEG+ ++  ++  ++     +E G + G+ I+ G+ SR      A  
Sbjct: 353 GTRKVCHISEIMGMEGDNVVLHNIFSFKPASTRNEQGNIQGEFINHGLFSRSSVRVNADI 412

Query: 463 YGEEKNLAEVLQSLEK 478
           Y     L  +   +EK
Sbjct: 413 YNLSNELNSIFSGMEK 428


>gi|325109817|ref|YP_004270885.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
 gi|324970085|gb|ADY60863.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
          Length = 455

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 248/374 (66%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + E+K  I T L+  +++  +   +    R E+   +  +   +   +S  E   L  ++
Sbjct: 23  FQELKKEIHTHLVSSMNLEWVGTMNDYELRRELRQGIRNLCQFRSELLSQSELERLINEV 82

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            ++ LG GP++PL+    ++DI+++G  +V++E +G+  +T I F DN  L+ + QRIV+
Sbjct: 83  IDETLGLGPIEPLLRDPTVSDILIDGPKRVYVERHGRLEDTDIQFHDNAHLIEIVQRIVS 142

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN +  PLALDG  ++IR+F +  +T   L+  G +T 
Sbjct: 143 KVGRRLDESSPMVDARLEDGSRVNAVTRPLALDGALVSIRRFGQQAITARELIQHGTLTP 202

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
                L    R R N++ISGGTGSGKTTLLN L+ +I   ER+VT ED AELQL+QP V 
Sbjct: 203 HMLEFLVACIRARLNIVISGGTGSGKTTLLNVLSGFIPAGERLVTIEDAAELQLRQPRVA 262

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETRP NIEG+G IT RDL++N LRMRP+RI++GE RGPE  D+LQAM TGH GS+ TI
Sbjct: 263 RMETRPANIEGKGAITARDLLRNALRMRPDRILIGECRGPEAFDMLQAMTTGHAGSLTTI 322

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+AR++  R+E ++ +GG+ LP + V E+I SS+ ++VQ  RL  G RR+T + EI G
Sbjct: 323 HANSARDALRRLEMLVGVGGYDLPPRFVHELIASSIQIVVQCHRLPSGERRVTQVTEITG 382

Query: 418 MEGNVIITQDLLKY 431
             G  + + DL ++
Sbjct: 383 TTGERMESHDLFEF 396


>gi|32471256|ref|NP_864249.1| secretory protein kinase [Rhodopirellula baltica SH 1]
 gi|32396958|emb|CAD71928.1| secretory protein kinase [Rhodopirellula baltica SH 1]
          Length = 458

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 175/398 (43%), Positives = 250/398 (62%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDL 113
           R   + ++K+ I   LI  ID+           R+E+     ++  +    +S  E+  L
Sbjct: 24  RENRFQQLKAEIHEKLISGIDMAVSRSVKEDRLREELRRGAEQLSRMHSDLLSQAERQRL 83

Query: 114 FEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQ 173
            ++L ++ +G GPL+PL+    ++DI+VNG + V++E  G    T I FRDN+ L+ + +
Sbjct: 84  IDELVDETMGLGPLEPLMRDPSVSDILVNGPDCVYVERGGVLEPTPIKFRDNDHLVDIVR 143

Query: 174 RIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFG 233
           +I  +VGRR+DESSP+ DARLLDGSR+N +IPPLALDG  ++IR+F    +T   L+   
Sbjct: 144 KIAGRVGRRIDESSPMVDARLLDGSRLNAVIPPLALDGALVSIRRFSTKPITAKSLIESN 203

Query: 234 AVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQ 293
           + T      L    R R N+LISGGTGSGKTTLLN L+ ++ K+ERI T ED AEL+LQQ
Sbjct: 204 SATPVMLDFLAACVRARMNILISGGTGSGKTTLLNLLSAFVPKEERIATIEDAAELRLQQ 263

Query: 294 PHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGS 353
           PHV R+ETR  N+EG G++T RDL+ N LRMRP+RII+GE RG E  D+LQAMNTGHDG 
Sbjct: 264 PHVARMETRVSNLEGRGQVTARDLLCNALRMRPDRIIMGECRGAEAFDMLQAMNTGHDGG 323

Query: 354 MGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNIC 413
           M TIH+N+ARE+  R+E +++M    LP   +   I S++ +IV   R+  G R+I  I 
Sbjct: 324 MSTIHSNDAREAVHRLEMLVSMAATDLPMWFIHRQIASAIHIIVHVTRMPGGERKIVQIS 383

Query: 414 EIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           E+ G+ G  +   DL  Y   G DE G+  G+  + G+
Sbjct: 384 EVTGVNGETVNMHDLFVYRQTGMDEHGRSQGRFEAKGI 421


>gi|269126093|ref|YP_003299463.1| type II secretion system protein E [Thermomonospora curvata DSM
           43183]
 gi|268311051|gb|ACY97425.1| type II secretion system protein E [Thermomonospora curvata DSM
           43183]
          Length = 470

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 196/450 (43%), Positives = 283/450 (62%), Gaps = 20/450 (4%)

Query: 29  SSNIQKQNLQSSSPSAEGEIGNFVNRTPH---------YYEVKSTIFTTLIEMIDITQLS 79
           S  + +   ++  P+AE      +  TPH         +  +K  +   L+E +      
Sbjct: 5   SERLARLQREAEQPAAEPTTA--LVHTPHRRSTRPLDPFAGLKRRVHQALVEALGP---R 59

Query: 80  QYDSQSARDE----IATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDD 135
            YD   +  E    + + +  ++  +   M+  ++  L +++ ++++G GPL+P +   +
Sbjct: 60  MYDVNLSAGELENRVRSTLQMVLEQEDTPMTAADRARLSQEIFDEVMGLGPLEPYLNDPE 119

Query: 136 IADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLL 195
           + +IMVNG  ++++E NG+       F     L     +IV +VGRR+DESSP+ DARL 
Sbjct: 120 VTEIMVNGPGQIYVERNGRLELAAGAFAGEGSLRRTIDKIVARVGRRIDESSPMVDARLP 179

Query: 196 DGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLI 255
           DGSRVN ++PP+ALDG  LTIRKF  D  T+  LV FG +T + A LL    R R N+LI
Sbjct: 180 DGSRVNAVVPPVALDGSLLTIRKFAADPFTVHDLVDFGTLTPQVADLLAACVRGRLNILI 239

Query: 256 SGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMR 315
           SGGTGSGKTT LN L+ +I  DERIVT ED+AELQL+Q HV+RLE+RPPNIEG GE+T+R
Sbjct: 240 SGGTGSGKTTTLNVLSSFIPPDERIVTIEDSAELQLRQEHVLRLESRPPNIEGRGEVTIR 299

Query: 316 DLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAM 375
           DLV+N LRMRP+RI++GEVR    LD+LQAMNTGHDGS+ T+HAN  RE+  R+E M+ M
Sbjct: 300 DLVRNALRMRPDRIVVGEVRDGAALDMLQAMNTGHDGSLTTVHANAPREAMARLETMVLM 359

Query: 376 GGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEV-M 434
            G  LP + +RE I S++D+++   R +DGSRRIT++ E+ G+EG VI  QD+  +++  
Sbjct: 360 SGMDLPVRAIREQIASAIDLVIHQARFKDGSRRITHVTEVSGLEGEVITLQDVFLFDMRA 419

Query: 435 GEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G D  G+ +G+   TG+ RPRF  R    G
Sbjct: 420 GVDADGRALGRLRPTGL-RPRFLERLLDAG 448


>gi|294102187|ref|YP_003554045.1| type II secretion system protein E [Aminobacterium colombiense DSM
           12261]
 gi|293617167|gb|ADE57321.1| type II secretion system protein E [Aminobacterium colombiense DSM
           12261]
          Length = 447

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 183/408 (44%), Positives = 267/408 (65%), Gaps = 13/408 (3%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARD--------EIATLMNEIVSVKKITMSLDE 109
           Y E    I + L + ID+ +++                 EI  ++ E+  +  + ++   
Sbjct: 25  YRETHRRILSRLADEIDMEEVASKPDWGKSPLVKEQITLEIQAMLEEVKGLNALEIN--- 81

Query: 110 QLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLL 169
              L +DL N++ GYGP+QPL+  D + +IMVNG  +VF+E  GK   T + F ++  + 
Sbjct: 82  --RLHDDLLNEVFGYGPIQPLLDDDTVTEIMVNGCEQVFVERWGKIEPTDVFFNNDNHIR 139

Query: 170 SVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHL 229
            +  +IV  +GRR+DE+SP+ DARL DGSRVN +IPP+++DGPTLT+RKF+++  T   L
Sbjct: 140 RIIDKIVAPLGRRIDEASPMVDARLPDGSRVNAVIPPVSIDGPTLTVRKFRREPFTAQDL 199

Query: 230 VSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAEL 289
           ++ G ++ E    L++    R N++++GGTGSGKTT LN L+ +I   ERIVT ED AEL
Sbjct: 200 IALGTLSDESVSFLRVATEARYNIIVTGGTGSGKTTTLNVLSSFIPNRERIVTIEDAAEL 259

Query: 290 QLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTG 349
            +QQ HVVR+E+RP NIEG G IT+R LV+N LRMRP+RII+GE RG E  D+LQAMNTG
Sbjct: 260 SMQQDHVVRMESRPVNIEGTGAITIRMLVRNSLRMRPDRIIVGECRGEEAFDMLQAMNTG 319

Query: 350 HDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRI 409
           HDGS+ T+HAN+ R+   R+E+M+ M G  LP + +RE I+S +D+IV  +RL+DG+RR+
Sbjct: 320 HDGSLTTLHANSPRDVLSRLESMVLMAGMELPVRAIREQISSGIDLIVHQERLKDGTRRV 379

Query: 410 TNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFW 457
           T+I EI GMEG+ I  QDL  +   G D+ G++ G    TG+   R +
Sbjct: 380 TSISEITGMEGDTIQMQDLFLFNHQGFDDAGRIRGNLDPTGIQPHRSY 427


>gi|119566860|gb|ABL84268.1| TadA [Yersinia ruckeri]
          Length = 428

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 243/340 (71%), Gaps = 1/340 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + + + ++I G+GPL+ L+  D I+DI+VNG  K+FIE  G    T + F +N QL  + 
Sbjct: 61  MIDSIADEITGFGPLRELMEDDSISDILVNGPEKIFIERKGLLELTNLRFINNSQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++  V RR+DES P+ DAR++DGSR+NV I P+ALDG  L+IRKF K+K TL+ LV+ 
Sbjct: 121 KRLMQNVNRRIDESRPLADARMIDGSRINVAIQPIALDGTVLSIRKFSKNKRTLEDLVNM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
            +++++ A  L I    + N++ISGGTGSGKTTLLN L++YI ++ERI+T ED AE+ L+
Sbjct: 181 ESLSSDMANFLSIAASCKVNIIISGGTGSGKTTLLNALSKYISENERIITLEDAAEISLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHV+R+ETR  ++E  GEITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVIRMETRLASLENTGEITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   VR  I S++++I+Q  R+ DGSR++ NI
Sbjct: 301 SMSTLHANTPRDAIARLESMILMGKVNMPISTVRRNIASAINIIIQVSRMNDGSRKVQNI 360

Query: 413 CEIVGMEGNVIITQDLLKYEVM-GEDETGKLIGQHISTGV 451
            EI+G+EG  +I QD+  Y+ + G DE   + G  I  G+
Sbjct: 361 SEIMGIEGENVIIQDIFTYKKLDGRDENNHVKGDFICHGL 400


>gi|42521751|ref|NP_967131.1| Flp pilus assembly protein TadA [Bdellovibrio bacteriovorus HD100]
 gi|39574281|emb|CAE77785.1| Flp pilus assembly protein TadA [Bdellovibrio bacteriovorus HD100]
 gi|51468907|emb|CAE47780.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 739

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 180/410 (43%), Positives = 266/410 (64%), Gaps = 7/410 (1%)

Query: 61  VKSTIFTTLIEMIDITQL------SQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLF 114
           +K  I   LI  +D+ +L       +   +  R++    +  IV  +   ++ +E+  L 
Sbjct: 286 LKIRIHNELIRTVDLKKLLVDGKQDENKEKEVREKTKREITLIVDREAPDVAREERSKLI 345

Query: 115 EDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQR 174
           +++  + LG GPL+ L+A  D+ +IMVNG+ +VF+E +GK   + + F  N+ L  + +R
Sbjct: 346 KEVLEEALGLGPLEDLLADPDVTEIMVNGNKRVFVEKSGKVQLSPVTFTSNDHLRRIIER 405

Query: 175 IVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGA 234
           IV  +GR++++S+P  DARL DGSRVN +I PLA+DGP LTIRKFKK  +T +  + +G+
Sbjct: 406 IVTPLGRQINDSTPYVDARLKDGSRVNAVIEPLAIDGPALTIRKFKKGGITAEKYIGYGS 465

Query: 235 VTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQP 294
           +T      L+I      NV+ISGGTGSGKT+LLN L+ +I  +ER++T ED AELQLQQ 
Sbjct: 466 ITKNMIDFLRICVENGLNVVISGGTGSGKTSLLNMLSSFIPSNERVITVEDAAELQLQQE 525

Query: 295 HVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSM 354
           HVVRLETRP ++EG   I +RDL+KN LRMRP+RII+GE R    LD+LQAMNTGHDGSM
Sbjct: 526 HVVRLETRPASMEGSNAIHIRDLIKNALRMRPDRIIVGECRDGAALDMLQAMNTGHDGSM 585

Query: 355 GTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICE 414
            T HAN+ RE   R+E +  M G  LP + +RE I  ++++IVQ  RL DGSR+I +I E
Sbjct: 586 TTTHANSPRECVARLETLCMMSGMDLPMRAIREQIAGAVNLIVQISRLSDGSRKILSITE 645

Query: 415 IVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           + GM+G+V+   ++ +++  G D+  K+ G   +TG + P F  + +  G
Sbjct: 646 VAGMQGDVVTLAEIFRFKETGYDKNRKIQGVFQATG-TIPSFIQKLSDKG 694


>gi|168699469|ref|ZP_02731746.1| secretory protein kinase [Gemmata obscuriglobus UQM 2246]
          Length = 457

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 179/406 (44%), Positives = 260/406 (64%), Gaps = 1/406 (0%)

Query: 60  EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCN 119
           + K+ +   L+  +D+T L+    +  R E+  +  E+       ++  E+  L  ++ +
Sbjct: 28  KFKAQLHRRLVVGMDLTALNALSREQLRQEVRRVAEELCQRSPNLLNQQERERLVNEVLD 87

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           +  G GPL+ L+    I+DI++NG + V+ E +G+   T + F D   LL + QR+V Q 
Sbjct: 88  ETFGLGPLETLMRDPTISDILINGPHTVYAERHGRLELTDVKFTDAAHLLHIVQRVVTQT 147

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRRVDE+ P+ D+RL DGSR+N IIPPLALDG  ++IR+F    +    LV+  ++ AE 
Sbjct: 148 GRRVDETCPMVDSRLPDGSRINAIIPPLALDGALVSIRRFGSKPIRAADLVANRSIPAEA 207

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
              L    R R NV++SGGTGSGKTTLLN L+ +I  DER++T ED AEL+LQQPHV R+
Sbjct: 208 MDFLAACVRARLNVVVSGGTGSGKTTLLNALSAFIPHDERVITIEDAAELRLQQPHVGRM 267

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           ETRP NIEG G +  R+LV+N LRMRP+RI++GE RGPE LD+LQAMNTGHDGS+ T+HA
Sbjct: 268 ETRPNNIEGVGAVGTRELVRNALRMRPDRIVIGECRGPEALDMLQAMNTGHDGSLTTVHA 327

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N+ RE+ GR+E M+ M GF LP  ++R  I +++ V+VQ  RL  G+R++T + E+ G E
Sbjct: 328 NDTREALGRLEVMVGMAGFDLPMWVIRRQIAAAVHVVVQVSRLVGGARKVTKVSEVTGAE 387

Query: 420 GNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGE 465
           G+  + QDL  ++  G D   +  G   +TG+ RP    R   +G 
Sbjct: 388 GDNFVMQDLFVFQQTGVDADRRAQGCFHATGL-RPNCLERLEAHGH 432


>gi|238755453|ref|ZP_04616793.1| Type II secretion protein [Yersinia ruckeri ATCC 29473]
 gi|238706294|gb|EEP98671.1| Type II secretion protein [Yersinia ruckeri ATCC 29473]
          Length = 428

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 170/340 (50%), Positives = 243/340 (71%), Gaps = 1/340 (0%)

Query: 113 LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           + + + ++I G+GPL+ L+  D I+DI+VNG  K+FIE  G    T + F +N QL  + 
Sbjct: 61  MIDSIADEITGFGPLRELMEDDSISDILVNGPEKIFIERKGLLELTNLRFINNSQLTDIA 120

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +R++  V RR+DES P+ DAR++DGSR+NV I P+ALDG  L+IRKF K+K TL+ LV+ 
Sbjct: 121 KRLMQNVNRRIDESRPLADARMIDGSRINVAIQPIALDGTVLSIRKFSKNKRTLEDLVNM 180

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
            +++++ A  L I    + N++ISGGTGSGKTTLLN L++YI ++ERI+T ED AE+ L+
Sbjct: 181 ESLSSDMANFLIIAASCKVNIIISGGTGSGKTTLLNALSKYISENERIITLEDAAEISLE 240

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
           QPHV+R+ETR  ++E  GEITMRDLV N LRMRP+RII+GE RG E  ++LQAMNTGH+G
Sbjct: 241 QPHVIRMETRLASLENTGEITMRDLVINSLRMRPDRIIIGECRGEETFEMLQAMNTGHNG 300

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN  R++  R+E+MI MG   +P   VR  I S++++I+Q  R+ DGSR++ NI
Sbjct: 301 SMSTLHANTPRDAIARLESMILMGKVNMPISTVRRNIASAINIIIQVSRMNDGSRKVQNI 360

Query: 413 CEIVGMEGNVIITQDLLKYEVM-GEDETGKLIGQHISTGV 451
            EI+G+EG  +I QD+  Y+ + G DE   + G  I  G+
Sbjct: 361 SEIMGIEGENVIIQDIFTYKKLDGRDENNHVKGDFICHGL 400


>gi|238782879|ref|ZP_04626908.1| Type II secretion protein [Yersinia bercovieri ATCC 43970]
 gi|238716302|gb|EEQ08285.1| Type II secretion protein [Yersinia bercovieri ATCC 43970]
          Length = 404

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 176/386 (45%), Positives = 257/386 (66%), Gaps = 2/386 (0%)

Query: 90  IATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFI 149
           I+   +E+ +  +  ++  +Q  + E + ++I G+GPL+ L+  D I+DIMVNG  K+FI
Sbjct: 15  ISQTYHELFNDNEHQLTTQDQKKIVEMIADEITGFGPLRELMEDDSISDIMVNGPEKIFI 74

Query: 150 EVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLAL 209
           E  G    +   F +N QL  + +R++ +V RR+DE  P+ DARL+DGSR+N  I P+ L
Sbjct: 75  ERYGLISLSDRRFINNTQLTDITKRLMQRVNRRIDEGRPLADARLVDGSRINAAISPITL 134

Query: 210 DGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNC 269
           DG  L+IRKF  +K  L+ LV  GA++++ A  L I    R N++ISGGTGSGKTTLL+ 
Sbjct: 135 DGTALSIRKFSNNKRKLEDLVDMGAMSSDMANFLIIAASCRVNIVISGGTGSGKTTLLSA 194

Query: 270 LTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERI 329
           L++YI ++ER++T ED AEL L+QPHVVR+ETR   +E  G+ITMRDLV N LRMRP+RI
Sbjct: 195 LSKYISENERVITLEDAAELNLEQPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRI 254

Query: 330 ILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREII 389
           I+GE RG E  ++LQAMNTGH+GSM T+HAN+ R++  R+E+MI MG   +P   +R  I
Sbjct: 255 IIGECRGEETFEMLQAMNTGHNGSMSTLHANSPRDAIARLESMIMMGPVNMPIFTIRRNI 314

Query: 390 TSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGE-DETGKLIGQHIS 448
            S++++IVQ  R+ DGSR++  I EI+GMEG  ++ QD+  ++   E D+ GK+ G  I+
Sbjct: 315 ASAINLIVQVSRMNDGSRKVRYISEIMGMEGENVVLQDIFSFKPDKERDQQGKIQGDFIN 374

Query: 449 TGV-SRPRFWNRAAQYGEEKNLAEVL 473
            G+ SR      A  Y     L+ + 
Sbjct: 375 HGLFSRSAVRINADIYNLSNELSSIF 400


>gi|89100214|ref|ZP_01173081.1| cpaF1, RSc0652; probable secretion ATPase protein [Bacillus sp.
           NRRL B-14911]
 gi|89085064|gb|EAR64198.1| cpaF1, RSc0652; probable secretion ATPase protein [Bacillus sp.
           NRRL B-14911]
          Length = 441

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 264/409 (64%), Gaps = 2/409 (0%)

Query: 57  HYY-EVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           HY  E+     T +++  ++  L+       R  I  L+++ +S +KI +   ++  L  
Sbjct: 24  HYISELVDHYKTRILKEANLEVLTNLPQGEMRLRIEQLISQYMSEEKIILPRHDKELLLT 83

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            + ++ +GYGPL+PL+    I +I++NG  +++IE  GK     I+FRD+  +  V  RI
Sbjct: 84  RIIDESIGYGPLEPLLNDATITEILINGPKEIYIEKLGKLQPAPISFRDDSHVRHVIDRI 143

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V  +GRR+D+SSP+ DARL DGSRVN +IPP++L+GP ++IRKF+KD   +  L+ F  +
Sbjct: 144 VAPLGRRIDDSSPMVDARLPDGSRVNAVIPPISLNGPLVSIRKFRKDPFKMSDLLKFETL 203

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
             + +  L  I + + NVLISGGTGSGKTTLLN L   I   ER++T ED+AEL+L +P+
Sbjct: 204 NDDMSVFLDAIVKSKLNVLISGGTGSGKTTLLNVLGNSIPAKERVITIEDSAELRLDKPN 263

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VV +E RP N+EGEGEIT+R LVKN LRMRP+RII+GEVRG E  D+LQAMNTGH+GS+ 
Sbjct: 264 VVGMEARPENMEGEGEITIRHLVKNSLRMRPDRIIVGEVRGAEAFDMLQAMNTGHEGSIT 323

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HAN   ++  R+E M+ M G  LPS ++RE I  +LD+IVQ+ RL DG+R+IT+ICEI
Sbjct: 324 TVHANTPFDALRRVEGMVIMAGMDLPSSIIREYIVGALDIIVQSSRLTDGTRKITSICEI 383

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
              E   I   ++  ++  G    G++ G    TG   P+   R   +G
Sbjct: 384 YRNENGEITINEIFTFKRNGLKGNGQVDGYFTPTG-HLPKCLERIKIFG 431


>gi|269966898|ref|ZP_06180971.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
 gi|269828565|gb|EEZ82826.1| Flp pilus assembly protein [Vibrio alginolyticus 40B]
          Length = 481

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 245/333 (73%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    I+DI+VNG   +F+E  GK  +T   F D   L ++  RIV+Q
Sbjct: 124 DEVFGLGPLEPLLEDQTISDILVNGPKNIFVERFGKLEKTPHTFLDERHLRNIIDRIVSQ 183

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSR N IIPPLA+DGP+++IR+F  ++L +D+L+  G+++ E
Sbjct: 184 VGRRIDEASPMVDARLKDGSRFNAIIPPLAIDGPSVSIRRFAVERLNMDNLLELGSLSPE 243

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ L        N+LISGGTGSGKTT LN L+ +I  D+RIVT ED+AELQLQQPH++R
Sbjct: 244 MAKFLNAAVVGEMNILISGGTGSGKTTTLNILSSFIPSDQRIVTIEDSAELQLQQPHIIR 303

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP NIEG+GEI+ RDLVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 304 LETRPSNIEGKGEISQRDLVKNSLRMRPDRIVVGEVRGSEAVDMLSAMNTGHDGSLATIH 363

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S+++++VQ  R  DG RR+ ++ EI GM
Sbjct: 364 ANTPRDALSRIENMFSMAGWNVSTKNLRAQIASAINIVVQMDRQEDGKRRMVSVQEINGM 423

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG+VI   ++  ++  G D+ G ++G +++TG+
Sbjct: 424 EGDVITMSEIFTFQRRGVDQEGNVLGDYMATGI 456


>gi|32477851|ref|NP_870845.1| secretory protein [Rhodopirellula baltica SH 1]
 gi|32448408|emb|CAD77923.1| putative secretory protein [Rhodopirellula baltica SH 1]
          Length = 469

 Score =  349 bits (896), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 179/390 (45%), Positives = 251/390 (64%), Gaps = 1/390 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           VK  +   L++ +D   L   +++  ++E+   + EI   +++ ++  E+  L +DL  +
Sbjct: 52  VKGRLHGQLLDDLDRRGLLTANNEQLKEEVDAFVAEIAETEQLPLNDSERSRLADDLLEE 111

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
            LG GPL PL+A   + DI+VNG + VF+E  GK   T + FRD++ L  + QRI  +VG
Sbjct: 112 TLGLGPLAPLMADPSVTDILVNGPHHVFVERYGKLELTEVEFRDDDHLTRIIQRIATRVG 171

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DES P+ DARL DGSRVN  +PP+ LDGPTL+IR+F + +L  + L   G      A
Sbjct: 172 RRIDESQPMVDARLPDGSRVNATLPPVTLDGPTLSIRRFGRRRLRAEELQRLGMFNPTMA 231

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
               +  R R N+LISGGTGSGK+T L  +   I  DER+VT ED AEL L Q HVVR+E
Sbjct: 232 EFFSVAVRSRLNILISGGTGSGKSTFLGAICESIPDDERVVTIEDAAELVLDQLHVVRME 291

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP N+EG G I  RDLV N LRMRP+RII+GEVR  E LD+LQAMNTGHDGS+ T+HAN
Sbjct: 292 TRPANVEGRGAIAARDLVVNALRMRPDRIIVGEVRAGETLDMLQAMNTGHDGSLTTVHAN 351

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           + R++  R+  M+ M G  LP   +RE I S++D+I   +R  DG RR+ ++ E+VG+EG
Sbjct: 352 SPRDAISRLSTMVLMSGMELPPTAIREQIVSAIDLIFHVRRYEDGVRRVESVDELVGLEG 411

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTG 450
           N    Q + ++ V G  +  +L G H++TG
Sbjct: 412 NTPQLQQIFRFNVSGR-KGKRLQGTHVATG 440


>gi|327538078|gb|EGF24768.1| type II/IV secretion system protein [Rhodopirellula baltica WH47]
          Length = 466

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 179/390 (45%), Positives = 251/390 (64%), Gaps = 1/390 (0%)

Query: 61  VKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCND 120
           VK  +   L++ +D   L   +++  ++E+   + EI   +++ ++  E+  L +DL  +
Sbjct: 49  VKGRLHGQLLDDLDRRGLLTANNEQLKEEVDAFVAEIAETEQLPLNDSERSRLADDLLEE 108

Query: 121 ILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVG 180
            LG GPL PL+A   + DI+VNG + VF+E  GK   T + FRD++ L  + QRI  +VG
Sbjct: 109 TLGLGPLAPLMADPSVTDILVNGPHHVFVERYGKLELTEVEFRDDDHLTRIIQRIATRVG 168

Query: 181 RRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGA 240
           RR+DES P+ DARL DGSRVN  +PP+ LDGPTL+IR+F + +L  + L   G      A
Sbjct: 169 RRIDESQPMVDARLPDGSRVNATLPPVTLDGPTLSIRRFGRRRLRAEELQRLGMFNPTMA 228

Query: 241 RLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLE 300
               +  R R N+LISGGTGSGK+T L  +   I  DER+VT ED AEL L Q HVVR+E
Sbjct: 229 EFFSVAVRSRLNILISGGTGSGKSTFLGAICESIPDDERVVTIEDAAELVLDQLHVVRME 288

Query: 301 TRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHAN 360
           TRP N+EG G I  RDLV N LRMRP+RII+GEVR  E LD+LQAMNTGHDGS+ T+HAN
Sbjct: 289 TRPANVEGRGAIAARDLVVNALRMRPDRIIVGEVRAGETLDMLQAMNTGHDGSLTTVHAN 348

Query: 361 NARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEG 420
           + R++  R+  M+ M G  LP   +RE I S++D+I   +R  DG RR+ ++ E+VG+EG
Sbjct: 349 SPRDAISRLSTMVLMSGMELPPTAIREQIVSAIDLIFHVRRYEDGVRRVESVDELVGLEG 408

Query: 421 NVIITQDLLKYEVMGEDETGKLIGQHISTG 450
           N    Q + ++ V G  +  +L G H++TG
Sbjct: 409 NTPQLQQIFRFNVSGR-KGKRLQGTHVATG 437


>gi|283778973|ref|YP_003369728.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
 gi|283437426|gb|ADB15868.1| type II secretion system protein E [Pirellula staleyi DSM 6068]
          Length = 490

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 176/395 (44%), Positives = 260/395 (65%), Gaps = 3/395 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           Y  V+  +   L++ +D + L     +   DE+   +   ++ + + ++ +E+  L +DL
Sbjct: 68  YLVVRGELHQRLLDELDRSNLLSSSEERLTDEVKEFVEGTLASEDLPLNEEERNRLVDDL 127

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
             + LG GPL PL++   + DI+VNGS +V+IE  G+   T + FRD+E L+ + QRI  
Sbjct: 128 LEETLGIGPLAPLMSDPAVTDILVNGSQQVYIERFGRLELTPVRFRDDEHLIRIIQRIAA 187

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DESSP+ DARL DGSRVN  +PP+ +DGPTL+IR+F   +L    L   G  ++
Sbjct: 188 RVGRRIDESSPMVDARLPDGSRVNATLPPVTIDGPTLSIRRFGHRRLRRSDLQQLGMFSS 247

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E  + L++  R R N+LISGGTGSGK+T L  +   I   ERIVT ED AEL L Q HV+
Sbjct: 248 EMLQFLELAVRGRKNLLISGGTGSGKSTFLGAIAEAIPDHERIVTIEDAAELILDQTHVI 307

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           R+ETRP N+EG G I  RDLV N LRMRP+RII+GE+R  E LD+LQA+NTGHDG M T+
Sbjct: 308 RMETRPANVEGRGRIAARDLVVNSLRMRPDRIIVGEIRSAEALDMLQALNTGHDGGMTTV 367

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E M+ M G  LPS+ +RE + S+L ++V  +R  DG RR+ +I E++G
Sbjct: 368 HANSPRDALSRVETMVLMAGLDLPSRAIREQMVSALHLVVHIRRYEDGVRRVESIAEVLG 427

Query: 418 MEGNVIITQDLLKYEVMGEDETG-KLIGQHISTGV 451
           +EGN    QD+ ++E   +   G +++G+ ++TG+
Sbjct: 428 LEGNTPQMQDIFRFE--PKTRVGRRIVGEFVATGI 460


>gi|332970972|gb|EGK09946.1| pilus assembly protein CpaF [Desmospora sp. 8437]
          Length = 461

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/396 (42%), Positives = 259/396 (65%), Gaps = 1/396 (0%)

Query: 69  LIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQ 128
           L++  D+ +L++  S   R  +  L+   ++ +++ +S  ++  L   + ++ +GYGPL+
Sbjct: 51  LLKETDLEKLTKMPSVELRVTLDRLIGRYMADEQVVISQQDRDRLITRIIDESVGYGPLE 110

Query: 129 PLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSP 188
           PL+   DI ++MVNG  +++ E  G+  +T I FRD E L  V  RIV  +GRRVD SSP
Sbjct: 111 PLLEDPDITEVMVNGPEEIYYEKKGRIHQTDIQFRDEEALRHVIDRIVAPLGRRVDVSSP 170

Query: 189 ICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGR 248
           + DARL DGSRVN +IPP++L G  L+IRKF+KD + ++ L+ F ++T + +  L  + +
Sbjct: 171 MVDARLPDGSRVNAVIPPISLKGSLLSIRKFRKDPIRMNDLIGFNSLTPDMSTFLTSVVK 230

Query: 249 IRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEG 308
            + N++ISGGTGSGKTTLLN L  +I ++ERIVT ED AEL++   HV  +E RP N+EG
Sbjct: 231 AKLNIIISGGTGSGKTTLLNALANFIPENERIVTIEDMAELRIPHGHVAGMEARPANVEG 290

Query: 309 EGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGR 368
           +GE+ +R LV+N LRMRP+RII+GEVRG E  D+LQAMNTGH+GS+ T+H+N+  ++  R
Sbjct: 291 KGEVNIRQLVRNALRMRPDRIIVGEVRGAEAFDMLQAMNTGHEGSLTTVHSNSPEDAMRR 350

Query: 369 MEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDL 428
           +EAM+ M    LP+ ++RE +  ++D I+Q  RL DG R++  I E+   E   +   DL
Sbjct: 351 LEAMVMMSSSELPASIIREYLVGAIDFIIQIARLPDGQRKMMAIAEMQKNEDGSVNLVDL 410

Query: 429 LKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
            ++E  G  E G++ G    TG   P+ + R   YG
Sbjct: 411 FRFEQTGVTEDGRVTGHFTPTG-EIPQCFKRLGAYG 445


>gi|76663416|emb|CAE47792.1| flp pilus assembling protein [Bdellovibrio bacteriovorus]
          Length = 741

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/357 (47%), Positives = 245/357 (68%), Gaps = 1/357 (0%)

Query: 108 DEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQ 167
           +E+  L +++  + LG GPL+ L+A  D+ +IMVNG+ +VF+E +GK   + + F  N+ 
Sbjct: 339 EERSKLIKEVLEEALGLGPLEDLLADPDVTEIMVNGNKRVFVEKSGKVQLSPVTFTSNDH 398

Query: 168 LLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLD 227
           L  + +RIV  +GR++++S+P  DARL DGSRVN +I PLA+DGP LTIRKFKK  +T +
Sbjct: 399 LRRIIERIVTPLGRQINDSTPYVDARLKDGSRVNAVIEPLAIDGPALTIRKFKKGGITAE 458

Query: 228 HLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA 287
             + +G++T      L+I      NV+ISGGTGSGKT+LLN L+ +I  +ER++T ED A
Sbjct: 459 KYIGYGSITKNMIDFLRICVENGLNVVISGGTGSGKTSLLNMLSSFIPSNERVITVEDAA 518

Query: 288 ELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMN 347
           ELQLQQ HVVRLETRP ++EG   I +RDL+KN LRMRP+RII+GE R    LD+LQAMN
Sbjct: 519 ELQLQQEHVVRLETRPASMEGSNAIHIRDLIKNALRMRPDRIIVGECRDGAALDMLQAMN 578

Query: 348 TGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSR 407
           TGHDGSM T HAN+ RE   R+E +  M G  LP + +RE I  ++++IVQ  RL DGSR
Sbjct: 579 TGHDGSMTTTHANSPRECVARLETLCMMSGMDLPMRAIREQIAGAVNLIVQISRLSDGSR 638

Query: 408 RITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +I +I E+ GM+G+V+   ++ +++  G D+  ++ G   +TG + P F  + +  G
Sbjct: 639 KILSITEVAGMQGDVVTLAEIFRFKETGYDKNRRIQGVFQATG-TIPSFIQKLSDKG 694


>gi|254229335|ref|ZP_04922752.1| type II/IV secretion system protein [Vibrio sp. Ex25]
 gi|151938143|gb|EDN56984.1| type II/IV secretion system protein [Vibrio sp. Ex25]
          Length = 481

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 245/333 (73%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    I+DI+VNG   +F+E  GK  +T   F D   L ++  RIV+Q
Sbjct: 124 DEVFGLGPLEPLLEDPTISDILVNGPKNIFVERFGKLEKTPHTFLDERHLRNIIDRIVSQ 183

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSR N IIPPLA+DGP+++IR+F  ++L +D+L+  G+++ E
Sbjct: 184 VGRRIDEASPMVDARLKDGSRFNAIIPPLAIDGPSVSIRRFAVERLNMDNLLELGSLSPE 243

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ L        N+LISGGTGSGKTT LN L+ +I  D+RIVT ED+AELQLQQPH++R
Sbjct: 244 MAKFLNAAVVGEMNILISGGTGSGKTTTLNILSGFIPSDQRIVTIEDSAELQLQQPHIIR 303

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP NIEG+GEI+ RDLVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 304 LETRPSNIEGKGEISQRDLVKNSLRMRPDRIVVGEVRGSEAVDMLSAMNTGHDGSLATIH 363

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S+++++VQ  R  DG RR+ ++ EI GM
Sbjct: 364 ANTPRDALSRIENMFSMAGWNVSTKNLRAQIASAINIVVQMDRQEDGKRRMVSVQEINGM 423

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG+VI   ++  ++  G D+ G ++G +++TG+
Sbjct: 424 EGDVITMSEIFTFQRRGVDQEGNVLGDYMATGI 456


>gi|222111307|ref|YP_002553571.1| fha domain-containing protein [Acidovorax ebreus TPSY]
 gi|221730751|gb|ACM33571.1| FHA domain containing protein [Acidovorax ebreus TPSY]
          Length = 594

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 190/450 (42%), Positives = 273/450 (60%), Gaps = 7/450 (1%)

Query: 20  PLPQEVVVSSSNIQKQNLQSSSPSAEGEIGNF-VNRTPHYYEVKSTIFTTLIEMIDI--T 76
           P+ Q +  +    +++ + S +P A  E+    V     +   +  I   LIE  D+  T
Sbjct: 135 PVTQRMASTPERTREEPVHSGAPIAPSEVRTASVQIDQDWLGYRRLIQEKLIESFDMRRT 194

Query: 77  QLSQYDSQSARDEIATLMNEIV--SVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARD 134
            + +   +  R+     + EI       I   +D+Q  L E++ ++ +G G L+PL+A  
Sbjct: 195 DVHRMGDKELREHTEQAIREIFLHMPAGIPADVDKQ-RLLEEVRDEAIGLGLLEPLLADP 253

Query: 135 DIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARL 194
              +IMVN  +++F+E  G+ V   + F   + ++ V +RIV  VGRR+DESSP+ DARL
Sbjct: 254 TTTEIMVNRVDEIFVERAGRLVRVPLAFSSEKAMMGVIERIVAPVGRRIDESSPLVDARL 313

Query: 195 LDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVL 254
            DGSR N IIPPLAL GP++TIRKF K KL  + L+ FG+  A+    LQ+  +   N++
Sbjct: 314 KDGSRFNAIIPPLALKGPSMTIRKFSKRKLGAEDLIKFGSANAQMVEFLQMAVKQHKNII 373

Query: 255 ISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITM 314
           +SGGTGSGKTTLLN L+ +I + ERIVT ED AELQL   H+V LE+RP N EG+G+I +
Sbjct: 374 VSGGTGSGKTTLLNILSNFIPEGERIVTIEDAAELQLHHEHLVSLESRPANAEGKGQIAI 433

Query: 315 RDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIA 374
           R+LVKN LRMRP+RI++GE RG E LD+LQAMNTGHDGS+ T HAN+ R+   R+E M+ 
Sbjct: 434 RELVKNSLRMRPDRIVVGECRGGEALDMLQAMNTGHDGSLTTAHANSPRDMLARLEVMVL 493

Query: 375 MGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVM 434
           M G  LP   +RE + S++D+IVQ  R   GSR+IT I E+ G+E   I  QDL ++   
Sbjct: 494 MAGMDLPVTAIREQVASAVDIIVQQTRFACGSRKITRITEVTGVESGKIQLQDLFEFVET 553

Query: 435 GEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G     K  G + +   + P F+ +  Q G
Sbjct: 554 GFTAERKTDG-YFTGCDAVPEFYEKLRQIG 582


>gi|262393422|ref|YP_003285276.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio sp. Ex25]
 gi|262337016|gb|ACY50811.1| type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF TadA
           subfamily [Vibrio sp. Ex25]
          Length = 458

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 245/333 (73%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    I+DI+VNG   +F+E  GK  +T   F D   L ++  RIV+Q
Sbjct: 101 DEVFGLGPLEPLLEDPTISDILVNGPKNIFVERFGKLEKTPHTFLDERHLRNIIDRIVSQ 160

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSR N IIPPLA+DGP+++IR+F  ++L +D+L+  G+++ E
Sbjct: 161 VGRRIDEASPMVDARLKDGSRFNAIIPPLAIDGPSVSIRRFAVERLNMDNLLELGSLSPE 220

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
            A+ L        N+LISGGTGSGKTT LN L+ +I  D+RIVT ED+AELQLQQPH++R
Sbjct: 221 MAKFLNAAVVGEMNILISGGTGSGKTTTLNILSGFIPSDQRIVTIEDSAELQLQQPHIIR 280

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP NIEG+GEI+ RDLVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 281 LETRPSNIEGKGEISQRDLVKNSLRMRPDRIVVGEVRGSEAVDMLSAMNTGHDGSLATIH 340

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S+++++VQ  R  DG RR+ ++ EI GM
Sbjct: 341 ANTPRDALSRIENMFSMAGWNVSTKNLRAQIASAINIVVQMDRQEDGKRRMVSVQEINGM 400

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG+VI   ++  ++  G D+ G ++G +++TG+
Sbjct: 401 EGDVITMSEIFTFQRRGVDQEGNVLGDYMATGI 433


>gi|148556414|ref|YP_001263996.1| type II secretion system protein E [Sphingomonas wittichii RW1]
 gi|148501604|gb|ABQ69858.1| type II secretion system protein E [Sphingomonas wittichii RW1]
          Length = 449

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 263/413 (63%), Gaps = 6/413 (1%)

Query: 58  YYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           Y   K+  +  +IE ++          S+  R+EI   +       ++ ++  E+L L E
Sbjct: 36  YQLAKAQTYAQVIEQLEARGNAADGPASRPLREEIEIAITSRSRRGQLALNSAERLLLIE 95

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+ +++ G+GPL PL+    + DI+VNG ++V++E  GK       F+D+  L+++  RI
Sbjct: 96  DIEDEVSGFGPLAPLLRDPTVDDIIVNGPHRVYVERTGKLTRVETRFQDDVHLMNIIHRI 155

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V Q+GRRVDE++P  DARL DGSRVN++IPP+A+DGP ++IRKF+   +++   V   ++
Sbjct: 156 VGQIGRRVDEANPYVDARLSDGSRVNIVIPPVAIDGPMVSIRKFRMQTMSIADFVERQSM 215

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           +A+ A  L    R R NVL+ GGTG+GKTTLLN L+ +ID+ +R++T ED AELQL+Q H
Sbjct: 216 SADMADFLAAAVRGRLNVLVCGGTGAGKTTLLNMLSSFIDESQRLITIEDAAELQLRQSH 275

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRP N+EG  E+  R+L++N LRMRP+RIILGEVRG E +++LQAM+TGHDGSM 
Sbjct: 276 VVRLETRPGNVEGSREVGSRELLRNALRMRPDRIILGEVRGVEAVEMLQAMSTGHDGSMA 335

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIH N+ R++F R+E ++   G     +  R  I SS+ ++V  QRL +GSRRI ++ E+
Sbjct: 336 TIHGNSPRDAFSRLEMLLGFAGLQNDIRATRRFIASSVHLLVHVQRLTNGSRRIMSVTEV 395

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKN 468
            G+EG      +L  +E   E      +G+   T   RP F +R   Y +E+ 
Sbjct: 396 TGIEGEAYSLNELFSFE---EQPPMSGLGE-FRTSSYRPHFADRIGNYRDERK 444


>gi|329912917|ref|ZP_08275836.1| type II secretion system protein E [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327545492|gb|EGF30692.1| type II secretion system protein E [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 577

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 190/446 (42%), Positives = 279/446 (62%), Gaps = 13/446 (2%)

Query: 5   RDKKLMGSVKREDNNPLPQEVVVSSSNIQKQN-LQSSSPSAEGEIGNFVNRTPHYYEVKS 63
           RD    G+  R DN      +V+   + Q  + L  + P       N   R   + + + 
Sbjct: 98  RDSATAGTTTRADNG-----IVMPEPDSQSDHALVPAGPLVMHASANPARRELEF-DWRR 151

Query: 64  TIFTTLIEMIDITQ--LSQYDSQSARDEIATLMNEIVSVKK--ITMSLDEQLDLFEDLCN 119
            +   L++ +D+ +  +S    Q  R +   L+ +I+  ++  I   LD  L L + + N
Sbjct: 152 RLHAELLQTMDLRRHDVSTMSDQQLRQDTDALIRQIMLAREADIPSELDRDL-LRQQVLN 210

Query: 120 DILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQV 179
           + +G GPL+ L+A D++++IMVN  +++++E  G+     + F     +L V +RIV  +
Sbjct: 211 EAIGLGPLEDLLADDEVSEIMVNRYDEIYVERAGRLHRHPLVFTGERAVLGVIERIVAPL 270

Query: 180 GRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEG 239
           GRR+DESSP+ DARL DGSRVN II PLAL G TLTIRKF + KL+ D LV  G+V+A  
Sbjct: 271 GRRIDESSPMVDARLKDGSRVNAIIAPLALKGATLTIRKFARRKLSADDLVRAGSVSAAM 330

Query: 240 ARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRL 299
           A  L+I    R N+++SGGTGSGKTTLLN L+ +I   ER++T ED AEL+L   H++ L
Sbjct: 331 AEFLRICVVARKNIVVSGGTGSGKTTLLNILSNFIPDHERVITVEDAAELKLHHAHLISL 390

Query: 300 ETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHA 359
           E RP N+EG+G +T+R+LV+N LRMRP+RI++GE RG E LD+LQAMNTGH+GS+ T+HA
Sbjct: 391 EARPANVEGKGAVTIRELVRNTLRMRPDRIVVGECRGAEALDMLQAMNTGHEGSLTTLHA 450

Query: 360 NNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGME 419
           N  R+   R+E M+ M G  LP Q +RE I+S++D+IVQ  R   G+R +T+I EI GME
Sbjct: 451 NTPRDGLARLETMVLMAGMDLPLQAIREQISSAVDIIVQQTRFACGTRMVTSITEITGME 510

Query: 420 GNVIITQDLLKYEVMGED-ETGKLIG 444
              I+ Q+L ++   G D + GK+ G
Sbjct: 511 SGKILLQELFRFASQGFDGKAGKVRG 536


>gi|237653359|ref|YP_002889673.1| type II secretion system protein E [Thauera sp. MZ1T]
 gi|237624606|gb|ACR01296.1| type II secretion system protein E [Thauera sp. MZ1T]
          Length = 474

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 184/413 (44%), Positives = 264/413 (63%), Gaps = 11/413 (2%)

Query: 59  YEVKSTIFTTLIEMIDITQ--LSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFED 116
           +  +  I   L++ ID+ +  L++      R E   L+ EI++ +    +L   LD  E 
Sbjct: 53  FTWRKRIHERLLDTIDLRRRDLNRMSDDELRAETTALVREIIAAEA---ALPGGLDR-EQ 108

Query: 117 LCNDIL----GYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVC 172
           LC+++L    G GPL+ L+  + +++IMVN  +++F+E  G+       F  +  +L V 
Sbjct: 109 LCSEVLDEAIGLGPLETLLTDESVSEIMVNRFDQIFVERGGRIAPHPTTFTSDRAVLGVI 168

Query: 173 QRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSF 232
           +RIV  +GRR+DESSP+ DARL DGSRVN IIPPLAL GPTLTIRKF +  L +  LV  
Sbjct: 169 ERIVAPLGRRIDESSPMVDARLRDGSRVNAIIPPLALKGPTLTIRKFARRALEVADLVRM 228

Query: 233 GAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQ 292
           G+++ E A  L+     R N+++SGGTGSGKTT LN L+ +I   ERI+T ED AEL+L+
Sbjct: 229 GSLSHEMAAFLRTCVEQRRNIVVSGGTGSGKTTFLNLLSNFIPDGERIITIEDAAELRLR 288

Query: 293 QPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDG 352
             H+V LE RP N+EG G I++RDLV+N LRMRP+RI++GE RG E LD+LQAMNTGH+G
Sbjct: 289 HSHLVSLEARPSNLEGRGAISIRDLVRNALRMRPDRIVVGECRGGEALDMLQAMNTGHEG 348

Query: 353 SMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNI 412
           SM T+HAN+ R++  R+E ++ M G  LP   +RE I S++D+IVQ  R   G+RR+T+I
Sbjct: 349 SMTTLHANSPRDALARLETLVLMAGMDLPLAAIREQIASAVDIIVQQTRFACGARRLTSI 408

Query: 413 CEIVGMEGNVIITQDLLKYEVMGEDE-TGKLIGQHISTGVSRPRFWNRAAQYG 464
            E+ GMEG  I  Q+L ++E    D  T    G H +   + P F++   + G
Sbjct: 409 TELTGMEGGRIQLQELFRFERRTADSPTADPSGGHFTGCDAVPGFYDELRRQG 461


>gi|163857689|ref|YP_001631987.1| putative Flp pilus assembly ATPase [Bordetella petrii DSM 12804]
 gi|163261417|emb|CAP43719.1| putative Flp pilus assembly ATPase [Bordetella petrii]
          Length = 451

 Score =  345 bits (886), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 260/409 (63%), Gaps = 12/409 (2%)

Query: 50  NFVNRTPHYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMN-EIVSV---KKITM 105
           +FV  +  Y EVK+  +  L+  I+  +L     + ARD I   ++ E+ S    K++ +
Sbjct: 16  SFVG-SARYQEVKTAAYEHLLSRIE--ELGAEFGRWARDAIQDFVDIEVASFARTKRVAI 72

Query: 106 SLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDN 165
           +  E   + E L  ++ G GPL+ L+A   + DI++NG + VF+   G      + F DN
Sbjct: 73  NEGEMRHIAEALTKELAGLGPLEDLLADPAVEDILINGYDNVFVSRGGVLTRESLGFSDN 132

Query: 166 EQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLT 225
           + +L + +RI+  +GRR+DESSP+ DARL DG R+NV+I PLA+DGP ++IRKF+KD L 
Sbjct: 133 QHVLRIVRRILAPIGRRLDESSPMVDARLPDGGRLNVVIEPLAVDGPMVSIRKFRKDPLK 192

Query: 226 LDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCED 285
              L++ G    +  RLL +    RCN+L+SGGT SGKT+LLN L  +I  +ER+VT ED
Sbjct: 193 PADLLTLGTFNEDIHRLLNMAVANRCNILVSGGTSSGKTSLLNALAFFIPTNERVVTVED 252

Query: 286 TAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQA 345
           TAEL L  PHVVRLE+R    +G+G +T+RDL++N LRMRP+R+++GEVRG EV+D+LQA
Sbjct: 253 TAELSLNHPHVVRLESRQGGFDGDGLVTIRDLIRNSLRMRPDRVVVGEVRGAEVMDMLQA 312

Query: 346 MNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDG 405
           MNTGH+GSM TIHAN+ RE   R+E +    GF      +R  I S+LD IVQ  RL +G
Sbjct: 313 MNTGHEGSMATIHANSPRECLYRIEMLAGFAGFQGSEDSLRRQIASALDFIVQIGRLPNG 372

Query: 406 SRRITNICEIVGMEGNVIITQDLLKYEVM-----GEDETGKLIGQHIST 449
            RR+ +I E+ GM   VI TQ+L ++E+       E +T   +G H  T
Sbjct: 373 KRRVLSITEVTGMGDTVIATQELYRHELFVTPDGEEKDTWSWLGVHPHT 421


>gi|255020085|ref|ZP_05292156.1| FHA domain containing protein [Acidithiobacillus caldus ATCC 51756]
 gi|254970447|gb|EET27938.1| FHA domain containing protein [Acidithiobacillus caldus ATCC 51756]
          Length = 574

 Score =  345 bits (885), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 177/403 (43%), Positives = 263/403 (65%), Gaps = 5/403 (1%)

Query: 73  IDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIA 132
           +D++ +S+ D Q     ++ L  E++   ++   LD +  L +++ ++ +G GPL+ L+A
Sbjct: 172 MDLSSMSREDLQRF---VSNLAAEVLQGMRLPPELDRE-RLIKEVVDEAVGLGPLEDLLA 227

Query: 133 RDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDA 192
            + + +IMVN  ++VFIE  G+       F   + + ++  RIV  +GRR+DESSP+ DA
Sbjct: 228 DETVTEIMVNRFDEVFIERRGRLEPAPTVFSSEQAVRNIIDRIVAPIGRRIDESSPLVDA 287

Query: 193 RLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCN 252
           RL DGSRVN +IPP+AL G  +TIRKF K +L ++ L+ FG+V    A  L++    R N
Sbjct: 288 RLHDGSRVNAVIPPVALKGANITIRKFSKKRLQMEDLIGFGSVEPRMAEFLRVAVEQRKN 347

Query: 253 VLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEI 312
           ++ISGGTGSGKTTLLN L+ +I  +ER+VT ED AEL+L QP++V +E RP N+EG+G I
Sbjct: 348 IIISGGTGSGKTTLLNVLSNFIPPNERVVTIEDAAELKLYQPNLVSMEARPANVEGKGAI 407

Query: 313 TMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAM 372
            +R+LV+N LRMRP+RI++GE RG E LD+LQAMNTGHDGS+ T HAN+ R+   RME M
Sbjct: 408 PIRELVRNALRMRPDRIVVGECRGGEALDMLQAMNTGHDGSLTTAHANSPRDMLSRMEVM 467

Query: 373 IAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYE 432
           + M G  LP   +RE I S++D+IVQ  R   GSR++T I E+ G E  VI  Q+L  ++
Sbjct: 468 VMMAGMELPLAAIREQIASAIDIIVQITRFSCGSRKLTAIVEVTGTESGVIQLQELFYFK 527

Query: 433 VMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQS 475
             G    GK+ G   ++G S P F+    + G   +++  L++
Sbjct: 528 QQGFGPDGKVRGTFRASG-SIPEFYEEMRERGLPVDMSLFLEA 569


>gi|28899186|ref|NP_798791.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153836815|ref|ZP_01989482.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AQ3810]
 gi|260361575|ref|ZP_05774602.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus K5030]
 gi|260876732|ref|ZP_05889087.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AN-5034]
 gi|260898190|ref|ZP_05906686.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus Peru-466]
 gi|260900403|ref|ZP_05908798.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AQ4037]
 gi|28807410|dbj|BAC60675.1| putative pilus assembly protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149749961|gb|EDM60706.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AQ3810]
 gi|308089074|gb|EFO38769.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus Peru-466]
 gi|308091515|gb|EFO41210.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AN-5034]
 gi|308109115|gb|EFO46655.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus AQ4037]
 gi|308114011|gb|EFO51551.1| Flp pilus assembly protein TadA [Vibrio parahaemolyticus K5030]
 gi|328474276|gb|EGF45081.1| Flp pilus assembly protein [Vibrio parahaemolyticus 10329]
          Length = 483

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 244/333 (73%)

Query: 119 NDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQ 178
           +++ G GPL+PL+    I+DI+VNG   +++E  GK  +T   F D   L ++  RIV+Q
Sbjct: 126 DEVFGLGPLEPLLEDPTISDILVNGPKNIYVERFGKLEKTPHTFLDERHLRNIIDRIVSQ 185

Query: 179 VGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAE 238
           VGRR+DE+SP+ DARL DGSR N IIPPLA+DGP+++IR+F  ++L +D+L+  G+++ E
Sbjct: 186 VGRRIDEASPMVDARLKDGSRFNAIIPPLAIDGPSVSIRRFAVERLNMDNLLGLGSLSPE 245

Query: 239 GARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVR 298
             + L        N+LISGGTGSGKTT LN L+ +I  D+RIVT ED+AELQLQQPH++R
Sbjct: 246 MGKFLNAAVVGELNILISGGTGSGKTTTLNILSGFIPSDQRIVTIEDSAELQLQQPHIIR 305

Query: 299 LETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIH 358
           LETRP NIEG+GEI+ RDLVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ TIH
Sbjct: 306 LETRPSNIEGKGEISQRDLVKNSLRMRPDRIVIGEVRGSEAVDMLSAMNTGHDGSLATIH 365

Query: 359 ANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGM 418
           AN  R++  R+E M +M G+ + ++ +R  I S+++++VQ +R  DG RR+ ++ EI GM
Sbjct: 366 ANTPRDALSRIENMFSMAGWNVSTKNLRAQIASAINIVVQMERQEDGKRRMVSLQEINGM 425

Query: 419 EGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
           EG VI   ++  ++  G D+ G ++G +I+TG+
Sbjct: 426 EGEVITMSEIFTFQRRGVDQDGNVLGDYIATGI 458


>gi|149178505|ref|ZP_01857093.1| secretion system protein TadA [Planctomyces maris DSM 8797]
 gi|148842620|gb|EDL56995.1| secretion system protein TadA [Planctomyces maris DSM 8797]
          Length = 444

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/409 (43%), Positives = 266/409 (65%), Gaps = 4/409 (0%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + + K  I   L++ +D++ L+Q   +    E+  +  EI       +   ++  L  +L
Sbjct: 27  FQKQKVIIHQELVDSLDLSMLAQISEKELSGEVRAVAMEICDDHASVLEGIDRERLLGEL 86

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G GPL  L+   +++DI+VN + ++ IE  G+  E+ + F DN+ L+ + QRIV+
Sbjct: 87  LSEVFGLGPLDQLMQDPEVSDILVNHAYEIHIEKAGQLQESDVIFADNQHLMRIIQRIVS 146

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           +VGRR+DE +P+ DARL DGSR+N IIPPLAL+GP+L+IR+F    L +D L+   +VT 
Sbjct: 147 RVGRRIDEVNPMVDARLPDGSRINAIIPPLALNGPSLSIRRFGTKPLQIDDLIEKKSVTP 206

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E    L  +   R ++LISGGTGSGKTT+LN L+ +I ++ER++T ED+AEL LQ  HVV
Sbjct: 207 EIVDFLAAVVDSRISMLISGGTGSGKTTMLNALSNFIPREERLITIEDSAELLLQHKHVV 266

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
           RLET+  N EG GEI+ R LVKN LRMRP+RII+GEVRG E LD+LQAMNTGH+GS+ T+
Sbjct: 267 RLETKVDNTEGVGEISQRQLVKNSLRMRPDRIIVGEVRGAEALDMLQAMNTGHEGSLTTV 326

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E M+AM GF LP  ++R+ I + + +I+   RL+ G R IT + EIV 
Sbjct: 327 HANDTRDALARLEMMVAMSGFDLPLPVIRQYIANGIGIILHVSRLKGGQRCITKVSEIVS 386

Query: 418 M--EGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           +  +G+  + +D+  +E  G D+ G   G+  +TG  RP    R    G
Sbjct: 387 LNSQGDYKV-EDIFGFEQTGIDDQGNAQGKFYATGY-RPACLKRMESSG 433


>gi|170701754|ref|ZP_02892690.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
 gi|170133337|gb|EDT01729.1| type II secretion system protein E [Burkholderia ambifaria
           IOP40-10]
          Length = 456

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 176/422 (41%), Positives = 264/422 (62%), Gaps = 14/422 (3%)

Query: 58  YYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E   + E
Sbjct: 20  FHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEVRTIAE 79

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            L  ++ G+GP++ L+A   + DI++NG N +++  +G  V+  I F DN  LL + +RI
Sbjct: 80  ALTKELAGFGPIEDLLADPHVEDILINGYNDIYVSRHGILVKLPIRFTDNAHLLRIVRRI 139

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           +  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+  G  
Sbjct: 140 LAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPADLLGNGTF 199

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
            AE   LL+     RCN+L+SGGT SGKT+LLN L  +I + ER+VT EDTAEL L  PH
Sbjct: 200 NAEIGALLEAAVEARCNILVSGGTSSGKTSLLNALAFHIPEPERVVTIEDTAELSLNHPH 259

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE+RP   +G G +++RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGHDGSMG
Sbjct: 260 VVRLESRPGGFDGTGVVSIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGHDGSMG 319

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI +I E+
Sbjct: 320 TVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRILSITEV 379

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQS 475
            G+  N+I TQ+L +YE     E     G+ + T       W     +     LA   Q+
Sbjct: 380 TGLSDNIIATQELYRYEARVTPE-----GEEVDT-------WESLGIHPHSPKLARFRQT 427

Query: 476 LE 477
           L+
Sbjct: 428 LQ 429


>gi|107022596|ref|YP_620923.1| type II secretion system protein E [Burkholderia cenocepacia AU
           1054]
 gi|116689545|ref|YP_835168.1| type II secretion system protein E [Burkholderia cenocepacia
           HI2424]
 gi|170732849|ref|YP_001764796.1| type II secretion system protein E [Burkholderia cenocepacia MC0-3]
 gi|206559896|ref|YP_002230660.1| flp pilus type assembly protein [Burkholderia cenocepacia J2315]
 gi|105892785|gb|ABF75950.1| type II secretion system protein E [Burkholderia cenocepacia AU
           1054]
 gi|116647634|gb|ABK08275.1| type II secretion system protein E [Burkholderia cenocepacia
           HI2424]
 gi|169816091|gb|ACA90674.1| type II secretion system protein E [Burkholderia cenocepacia MC0-3]
 gi|198035937|emb|CAR51829.1| flp pilus type assembly protein [Burkholderia cenocepacia J2315]
          Length = 450

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 171/383 (44%), Positives = 252/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++  E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNESEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N +++  +G   +  I F DN  LL 
Sbjct: 75  RAVAEALTKELAGFGPIEDLLADPHVEDILINGYNDIYVSRHGILSKLPIRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  VGRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L  + L+
Sbjct: 135 IVRRILAPVGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPEDLL 194

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G    E  RLL+     RCNVL+SGGT SGKT+LLN L  +I   ER+VT EDTAEL 
Sbjct: 195 GNGTYNEEIGRLLEAAVDARCNVLVSGGTSSGKTSLLNALAFHIPMAERVVTIEDTAELS 254

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L  PHVVRLE+RP   +G G +T+RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGH
Sbjct: 255 LNHPHVVRLESRPGGFDGSGVVTIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGH 314

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI 
Sbjct: 315 DGSMGTVHASSPRECLYRLEMLAGFAGFQGTEASLRRQIANAIDFIVQIGRLSNGRRRIL 374

Query: 411 NICEIVGMEGNVIITQDLLKYEV 433
           +I E+ GM  N++ TQ+L +YE 
Sbjct: 375 SITEVTGMSDNIVSTQELYRYEA 397


>gi|319788660|ref|YP_004148135.1| FHA domain containing protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317467172|gb|ADV28904.1| FHA domain containing protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 566

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 181/411 (44%), Positives = 274/411 (66%), Gaps = 13/411 (3%)

Query: 62  KSTIFTTLIEMIDITQLS--QYDSQSARDEIATLMNEIVSVKKITMSLDEQLD---LFED 116
           ++ +   L+  +D+ ++     D Q+ RD    L+++I+  K+    L + ++   L + 
Sbjct: 146 RTRLHMALVRQMDLRRMDVRSMDDQALRDTTINLIDDIL--KREFQDLPKDINPRVLAKQ 203

Query: 117 LCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIV 176
           + ++ +G GPL+ LIA D + +IMVN  +++FIE  G+  ++ + F +    L+  +RIV
Sbjct: 204 VLDEAIGLGPLEDLIADDSVTEIMVNAHDEIFIEREGRIRKSEVVFSNERACLAAIERIV 263

Query: 177 NQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVT 236
             +GRR+DESSP+ DARL DGSRVN +IPP+AL GP+++IRKF K +L  + L++FG++ 
Sbjct: 264 TPLGRRIDESSPLVDARLKDGSRVNAVIPPVALRGPSISIRKFAKRRLMGEDLLTFGSLD 323

Query: 237 AEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHV 296
                 L I  R R N+++SGGTGSGKTTLLN L+ +I   +R+VT ED AEL+L QP++
Sbjct: 324 ERMLEFLTIAVRERRNIVVSGGTGSGKTTLLNILSNFIPDADRVVTIEDAAELKLVQPNL 383

Query: 297 VRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGT 356
           V LE RP N+EG+G+IT+RDLVKN LRMRP+RI++GE RG E LD+LQAMNTGH+GS+ T
Sbjct: 384 VALEARPANMEGKGQITIRDLVKNALRMRPDRIVVGECRGGESLDMLQAMNTGHEGSLTT 443

Query: 357 IHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIV 416
            HANN RE+  R+E M+ M G  LP  +VRE I S++++IV  +R   GSR++++I EI 
Sbjct: 444 AHANNPRETLSRLEVMVMMAGMELPMTVVREQIASAVNLIVHQRRYPCGSRKVSHITEIT 503

Query: 417 GMEGNVIITQDLLKYE---VMGEDETGKLIGQHISTGVSRPRFWNRAAQYG 464
           G+E   I  QD+  ++     G D  G++ G  ++TG + P F+   A+ G
Sbjct: 504 GIESGTIQMQDIFLFKPTTYHGPD--GRVAGNFVATG-AVPEFYEALAERG 551


>gi|325111217|ref|YP_004272285.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
 gi|324971485|gb|ADY62263.1| type II secretion system protein E [Planctomyces brasiliensis DSM
           5305]
          Length = 450

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/393 (42%), Positives = 255/393 (64%)

Query: 58  YYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFEDL 117
           + ++K+ +   +I+ +D+++  Q      R ++  L + +  +    +   E+  +  ++
Sbjct: 21  FQQLKTRLHRQMIDAMDLSKAGQLPEHELRKQLRALASHLCEMHSSYLPESEREQMVNEI 80

Query: 118 CNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVN 177
            +++ G+GPL+PL+   D++D++VNG++ +F+E NG+   T + F DN  LL + QR+V 
Sbjct: 81  MDEMYGFGPLEPLMNDPDVSDVLVNGADTIFVERNGRLQLTDVRFADNNHLLHLIQRLVG 140

Query: 178 QVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTA 237
           + GRR+DE SP+ DA+L DGSR++ +IPPL   GPTL+IR+F    + L+ +V   ++T 
Sbjct: 141 RAGRRIDEVSPMVDAKLPDGSRLHAVIPPLTSRGPTLSIRRFSSAAVQLEDMVRIQSMTR 200

Query: 238 EGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVV 297
           E A  L    R R NVL+SGGTG+GKTT+LN L R+I  +ER++T E+TAELQLQQ  VV
Sbjct: 201 EMAEFLVSAVRGRLNVLLSGGTGAGKTTMLNQLGRFIPANERVITIEETAELQLQQADVV 260

Query: 298 RLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTI 357
            LETR PN+EG G IT R+L++N LRMRP+RII+GE RG EVL++LQAMNTGHDGSM T+
Sbjct: 261 GLETRLPNVEGRGGITQRELLRNSLRMRPDRIIVGEARGSEVLEMLQAMNTGHDGSMSTV 320

Query: 358 HANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVG 417
           HAN+ R++  R+E MIA+ G  L   + R  I S++ +++   RL  G R++T I E+ G
Sbjct: 321 HANDTRDALDRLELMIALAGADLQPTVARRYIASAVHILLHVVRLSTGERKVTRISELAG 380

Query: 418 MEGNVIITQDLLKYEVMGEDETGKLIGQHISTG 450
                   +D+  Y + G    G+  G   +TG
Sbjct: 381 TRDGEYNVEDIFVYRMTGIGSDGRAEGAFYATG 413


>gi|134295597|ref|YP_001119332.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
 gi|134138754|gb|ABO54497.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
          Length = 458

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 252/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N V++  +G   +  + F DN  LL 
Sbjct: 75  RAIAEALTKELAGFGPIEDLLADPAVEDILINGYNDVYVSRHGMLAKLPVRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+
Sbjct: 135 IVRRILAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPIVSIRKFRKDPLKPSDLL 194

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G    E   LL+     RCNVL+SGGT SGKT+LLN L  +I + ER+VT EDTAEL 
Sbjct: 195 GNGTYNEEIGALLEAAVEARCNVLVSGGTSSGKTSLLNALAFHIPEPERVVTIEDTAELS 254

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L  PHVVRLE+RP   +G G +T+RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGH
Sbjct: 255 LNHPHVVRLESRPGGFDGSGVVTIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGH 314

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI 
Sbjct: 315 DGSMGTVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRIL 374

Query: 411 NICEIVGMEGNVIITQDLLKYEV 433
           +I E+ G+  N+I TQ+L +YE 
Sbjct: 375 SITEVTGLSDNIIATQELYRYEA 397


>gi|91775993|ref|YP_545749.1| type II secretion system protein E [Methylobacillus flagellatus KT]
 gi|91709980|gb|ABE49908.1| type II secretion system protein E [Methylobacillus flagellatus KT]
          Length = 417

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 249/355 (70%), Gaps = 4/355 (1%)

Query: 86  ARDEIATLMNE----IVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMV 141
           +R ++ T +N      V+ K++ +S  E   L E++ +++ G+GPL+ LI  D I DI+V
Sbjct: 42  SRQQMMTYVNSKVYRYVAEKQLVVSAYELEKLTEEMVDELAGFGPLETLIKDDSINDILV 101

Query: 142 NGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVN 201
           NG+  +F+E  G+  ++ + F D+E +L V +RI++ +GRRVDE+SP  DARL DGSR+N
Sbjct: 102 NGARDIFVERKGRLEKSQLRFIDDEHVLRVIRRILSPLGRRVDEASPTVDARLPDGSRLN 161

Query: 202 VIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGS 261
           VIIPPLAL+GP ++IRKF+K  +  + L+++G + ++    L    + R N +ISGGTG+
Sbjct: 162 VIIPPLALNGPCMSIRKFRKTPILGNDLLAYGTLNSQMLSFLTNAAQRRVNTIISGGTGA 221

Query: 262 GKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNC 321
           GKTTLLN ++R I   ERIVT ED AEL+L+  HVVRLETRP N++G GE++  DLV+N 
Sbjct: 222 GKTTLLNFMSRSIPPGERIVTIEDAAELRLEHDHVVRLETRPHNLDGVGEVSAHDLVRNA 281

Query: 322 LRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLP 381
           LRMRP+RIILGEVR  EV+D+LQAMNTGH+G M T+HANN  ++  R+E +  + GF   
Sbjct: 282 LRMRPDRIILGEVRSKEVMDMLQAMNTGHEGCMSTVHANNPSDALLRLETLAGLAGFQGA 341

Query: 382 SQMVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGE 436
              +R++I +++++IVQ  R+ DG RRIT+I E+VG+  +  +T +L  Y+V  E
Sbjct: 342 EATLRKMIAAAIELIVQVTRMPDGRRRITSIVEVVGLRDDRFVTNELFSYQVEQE 396


>gi|78066133|ref|YP_368902.1| Flp pilus assembly protein ATPase CpaF [Burkholderia sp. 383]
 gi|77966878|gb|ABB08258.1| Flp pilus assembly protein ATPase CpaF [Burkholderia sp. 383]
          Length = 447

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 251/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++  E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNESEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N +++  +G      I F DN  LL 
Sbjct: 75  RAVAEALTKELAGFGPIEDLLADPHVEDILINGYNDIYVSRHGILSRLPIRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  VGRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L  + L+
Sbjct: 135 IVRRILAPVGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPEDLL 194

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G    E  RLL+     RCN+L+SGGT SGKT+LLN L  +I   ER+VT EDTAEL 
Sbjct: 195 GNGTFNEEIGRLLEAAVEARCNILVSGGTSSGKTSLLNALAFHIPMVERVVTIEDTAELS 254

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L  PHVVRLE+RP   +G G +T+RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGH
Sbjct: 255 LNHPHVVRLESRPGGFDGSGVVTIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGH 314

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI 
Sbjct: 315 DGSMGTVHASSPRECLYRLEMLAGFAGFQGTEASLRRQIANAIDFIVQIGRLSNGRRRIL 374

Query: 411 NICEIVGMEGNVIITQDLLKYEV 433
           +I E+ GM  N++ TQ+L +YE 
Sbjct: 375 SITEVTGMSDNIVSTQELYRYEA 397


>gi|115351458|ref|YP_773297.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
 gi|115281446|gb|ABI86963.1| type II secretion system protein E [Burkholderia ambifaria AMMD]
          Length = 454

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 175/422 (41%), Positives = 263/422 (62%), Gaps = 14/422 (3%)

Query: 58  YYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E   + E
Sbjct: 20  FHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEVRTIAE 79

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            L  ++ G+GP++ L+A   + DI++NG N +++  +G   +  I F DN  LL + +RI
Sbjct: 80  ALTKELAGFGPIEDLLADPHVEDILINGYNDIYVSRHGILAKLPIRFTDNAHLLRIVRRI 139

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           +  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+  G  
Sbjct: 140 LAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPADLLGNGTF 199

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
            AE   LL+     RCN+L+SGGT SGKT+LLN L  +I + ER+VT EDTAEL L  PH
Sbjct: 200 NAELGALLEAAVEARCNILVSGGTSSGKTSLLNALAFHIPEPERVVTIEDTAELSLNHPH 259

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE+RP   +G G +++RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGHDGSMG
Sbjct: 260 VVRLESRPGGFDGTGVVSIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGHDGSMG 319

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI +I E+
Sbjct: 320 TVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRILSITEV 379

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRFWNRAAQYGEEKNLAEVLQS 475
            G+  N+I TQ+L +YE     E     G+ + T       W     +     LA   Q+
Sbjct: 380 TGLSDNIIATQELYRYEARVTPE-----GEEVDT-------WESLGIHPHSPKLARFRQT 427

Query: 476 LE 477
           L+
Sbjct: 428 LQ 429


>gi|307295327|ref|ZP_07575166.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
 gi|306878830|gb|EFN10049.1| type II secretion system protein E [Sphingobium chlorophenolicum
           L-1]
          Length = 439

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 176/377 (46%), Positives = 249/377 (66%), Gaps = 6/377 (1%)

Query: 84  QSARDEIATLMNEIVSVKKITMSLDEQLDLFEDLCNDILGYGPLQPLIARDDIADIMVNG 143
           ++ R+EI  ++       ++ ++  E+L L ED+ +++ G GPL PL+    + DI+VNG
Sbjct: 61  KALREEIERVIASRSRRGQLALNSAERLLLIEDVEDEVAGMGPLAPLLRDPGVDDIIVNG 120

Query: 144 SNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVI 203
              V+ E  G   +    FRD+  L+++ QRIV  VGRRVDE+SP  DARL DGSRVN++
Sbjct: 121 PGHVYAERGGLLEKVETRFRDDAHLMNIIQRIVGPVGRRVDEASPYVDARLADGSRVNIV 180

Query: 204 IPPLALDGPTLTIRKFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGK 263
           IPP+ALDGPTL+IRKF+   +T++  V+   ++A  A  L    R R N+LI GGTG+GK
Sbjct: 181 IPPVALDGPTLSIRKFRLQSMTIEDCVARQVMSAGMAAYLGAAVRSRLNILICGGTGAGK 240

Query: 264 TTLLNCLTRYIDKDERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLR 323
           TTLLN L+ +I   ER++T ED AELQL+Q HVVRLETRPP ++G  E++ R+LV+N LR
Sbjct: 241 TTLLNMLSTFIGDRERLITIEDAAELQLRQSHVVRLETRPPTVDGSREVSSRELVRNALR 300

Query: 324 MRPERIILGEVRGPEVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQ 383
           MRP+RIILGEVRG E +++LQAM+TGHDGSM T+H N+ R++F R+E ++   G     +
Sbjct: 301 MRPDRIILGEVRGVEAVEMLQAMSTGHDGSMATLHGNSPRDAFARLEMLLGFAGVQSDIR 360

Query: 384 MVREIITSSLDVIVQTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLI 443
            VR  I +S+ V+VQ QRL +GSRR+ ++ E+ G+EG+     +L  +E     E   L 
Sbjct: 361 AVRRFIANSVHVVVQLQRLSNGSRRVMSVSEVTGLEGDAYSLNELFLFE-----EQPALS 415

Query: 444 GQ-HISTGVSRPRFWNR 459
           G     T  SRP F  R
Sbjct: 416 GMGEFRTLSSRPHFAGR 432


>gi|159899026|ref|YP_001545273.1| type II secretion system protein E [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159892065|gb|ABX05145.1| type II secretion system protein E [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 513

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 172/359 (47%), Positives = 243/359 (67%), Gaps = 3/359 (0%)

Query: 100 VKKITMSLDEQLD--LFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVE 157
           V++ T +LD+     L++ + +++ G+GPL+ LI  D I +IMVN +  V++E  GK   
Sbjct: 131 VRQSTTNLDQDGTKLLYQMVLDELFGFGPLEQLIRDDTITEIMVNSATVVYVEQKGKLTL 190

Query: 158 TGINFRDNEQLLSVCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIR 217
           + + F   + +L V  RI+  +GRRVD   P+ DARL DGSRVN IIPP A+DG +L+IR
Sbjct: 191 SPVIFASEDHVLKVIDRIIRPLGRRVDRKWPMVDARLPDGSRVNAIIPPCAIDGSSLSIR 250

Query: 218 KFKKDKLTLDHLVSFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKD 277
           KF K KL +  L+++G++T E A  L        N+++SGGTGSGKTTLLN L+ +I   
Sbjct: 251 KFSKKKLQVSDLINYGSMTKEMADFLNACVVSAMNLIVSGGTGSGKTTLLNVLSNFIPDH 310

Query: 278 ERIVTCEDTAELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGP 337
            RI T ED+AELQL + HV+RLE++P +++G G +T+RDLVKN LRMRP+RI++GE+R  
Sbjct: 311 YRICTIEDSAELQLGKDHVIRLESKPADVDGSGLVTIRDLVKNSLRMRPDRIVVGEIRDG 370

Query: 338 EVLDLLQAMNTGHDGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIV 397
             LDLLQAMNTGHDGSM T+HAN  R++  R+E +  M G  LP  ++RE I S++ VIV
Sbjct: 371 AALDLLQAMNTGHDGSMSTVHANTPRDAIRRLETLALMSGLDLPVAVIREQIASAVHVIV 430

Query: 398 QTQRLRDGSRRITNICEIVGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVSRPRF 456
           Q  RLRDGSR++  + E+ GME   ++ QD+  +E  G    GK++G    TG +RPRF
Sbjct: 431 QQARLRDGSRKVVAVTEVQGMESGQVVLQDIFIFEDQGTAPDGKVMGVLRPTG-TRPRF 488


>gi|294146462|ref|YP_003559128.1| pilus assembly protein CpaF [Sphingobium japonicum UT26S]
 gi|292676879|dbj|BAI98396.1| pilus assembly protein CpaF [Sphingobium japonicum UT26S]
          Length = 442

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 178/409 (43%), Positives = 258/409 (63%), Gaps = 8/409 (1%)

Query: 58  YYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           Y   K+     LIE ++           ++ R+EI  +++      ++ ++  E+L L E
Sbjct: 33  YQLAKAQTCAQLIEQLEARGETAETLGPRALREEIEQVISSRSRRGQMALNSAERLLLIE 92

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
           D+ +++ G GPL PL+    + DI+VNG   V+ E  G   +    FRD+  L+++ QRI
Sbjct: 93  DVEDEVAGMGPLAPLLRDPGVDDIIVNGPGHVYAERGGLLEKVETRFRDDAHLMNIIQRI 152

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V  +GRRVDE+SP  DARL DGSRVN++IPP+ALDGPTL+IRKF+   +T++  V+   +
Sbjct: 153 VGPIGRRVDEASPYVDARLADGSRVNIVIPPVALDGPTLSIRKFRLQSMTIEDCVAGQVM 212

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           +A+ A  L    R R N+LI GGTG+GKTTLLN L+ +I   ER++T ED AELQL+Q H
Sbjct: 213 SADMAAYLSAAVRSRLNILICGGTGAGKTTLLNMLSTFIGDRERLITIEDAAELQLRQSH 272

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLETRPP ++G  E++ R+LV+N LRMRP+RIILGEVRG E +++LQAM+TGHDGSM 
Sbjct: 273 VVRLETRPPTVDGSREVSSRELVRNALRMRPDRIILGEVRGVEAVEMLQAMSTGHDGSMA 332

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           T+H N+ R++F R+E ++   G     + +R  I +S+ V+VQ QRL +GSRR+ ++ E+
Sbjct: 333 TLHGNSPRDAFARLEMLLGFAGVQSDVRAIRRFIANSVHVVVQLQRLSNGSRRVMSVSEV 392

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIG-QHISTGVSRPRFWNRAAQY 463
            G+EG      +L  ++     E   L G     T   RP F  R   Y
Sbjct: 393 TGLEGEAYSLNELFAFQ-----EQPALSGLGEFQTLSPRPFFAGRLRDY 436


>gi|172060497|ref|YP_001808149.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
 gi|171993014|gb|ACB63933.1| type II secretion system protein E [Burkholderia ambifaria MC40-6]
          Length = 455

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 251/382 (65%), Gaps = 2/382 (0%)

Query: 54  RTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQL 111
           +T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E  
Sbjct: 16  QTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEVR 75

Query: 112 DLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSV 171
            + E L  ++ G+GP++ L+A   + DI++NG N V++  +G   +  + F DN  LL +
Sbjct: 76  AIAEALTKELAGFGPIEDLLADPAVEDILINGYNDVYVSRHGMLAKLPVRFTDNAHLLRI 135

Query: 172 CQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVS 231
            +RI+  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+ 
Sbjct: 136 VRRILAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPIVSIRKFRKDPLKPSDLLG 195

Query: 232 FGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQL 291
            G    E   LL+     RCNVL+SGGT SGKT+LLN L  +I + ER+VT EDTAEL L
Sbjct: 196 NGTYNEEIGALLEAAVEARCNVLVSGGTSSGKTSLLNALAFHIPEVERVVTIEDTAELSL 255

Query: 292 QQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHD 351
             PHVVRLE+RP   +G G +T+RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGHD
Sbjct: 256 NHPHVVRLESRPGGFDGTGVVTIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGHD 315

Query: 352 GSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITN 411
           GSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI +
Sbjct: 316 GSMGTVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRILS 375

Query: 412 ICEIVGMEGNVIITQDLLKYEV 433
           I E+ G+  N+I TQ+L +YE 
Sbjct: 376 ITEVTGLSDNIIATQELYRYEA 397


>gi|269960462|ref|ZP_06174834.1| Flp pilus assembly protein [Vibrio harveyi 1DA3]
 gi|269834539|gb|EEZ88626.1| Flp pilus assembly protein [Vibrio harveyi 1DA3]
          Length = 482

 Score =  342 bits (877), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 180/396 (45%), Positives = 265/396 (66%), Gaps = 7/396 (1%)

Query: 57  HYYEVKSTIFTTLIEMIDITQLSQYDSQSARDEIATLMNEIVSVKKI-TMSLDEQLDLFE 115
           HYY  K      L        LS      A++E+   + ++++  +   +S + +  +  
Sbjct: 68  HYYHKKLLDTLDL------GLLSHLQEDRAKEELREAVVQLIAEDQTHPLSSEARSRVIH 121

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            + +++ G GPL+PL+    I+DI+VNG   +++E  GK  +T   F D   L ++  RI
Sbjct: 122 QIEDEVFGLGPLEPLLDDPTISDILVNGPKNIYVERFGKLEKTPHTFLDERHLRNIIDRI 181

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           V+QVGRR+DE+SP+ DARL DGSR N IIPPLA+DGP+++IR+F  ++L +D+L+   ++
Sbjct: 182 VSQVGRRIDEASPMVDARLKDGSRFNAIIPPLAIDGPSVSIRRFAVERLNMDNLLELNSL 241

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
           + E  + L        N+LISGGTGSGKTT LN L+ +I  D+RIVT ED+AELQLQQPH
Sbjct: 242 SPEMGKFLNAAVVGEMNILISGGTGSGKTTTLNILSGFIPSDQRIVTIEDSAELQLQQPH 301

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           ++RLETRP NIEG+GEI+ RDLVKN LRMRP+RI++GEVRG E +D+L AMNTGHDGS+ 
Sbjct: 302 IIRLETRPSNIEGKGEISQRDLVKNSLRMRPDRIVIGEVRGAEAVDMLSAMNTGHDGSLA 361

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHAN  R++  R+E M +M G+ + ++ +R  I S+++++VQ +R  DG RR+ ++ EI
Sbjct: 362 TIHANTPRDALSRIENMFSMAGWNVSTKNLRAQIASAINIVVQMERQEDGKRRMVSLQEI 421

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGV 451
            GMEG VI   ++  +   G D+ G +IG + STG+
Sbjct: 422 NGMEGEVITMSEIFTFRRRGVDKEGNVIGDYESTGI 457


>gi|171317115|ref|ZP_02906318.1| type II secretion system protein E [Burkholderia ambifaria MEX-5]
 gi|171097749|gb|EDT42576.1| type II secretion system protein E [Burkholderia ambifaria MEX-5]
          Length = 456

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 250/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N V++  +G      + F DN  LL 
Sbjct: 75  RAIAEALTKELAGFGPIEDLLADQAVEDILINGYNDVYVSRHGILARLPVRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+
Sbjct: 135 IVRRILAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPADLL 194

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G    E   LL+     RCN+L+SGGT SGKT+LLN L  +I   ER+VT EDTAEL 
Sbjct: 195 GNGTFNEEIGTLLEAAVEARCNILVSGGTSSGKTSLLNALAFHIPDAERVVTIEDTAELS 254

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L  PHVVRLE+RP   +G G +T+RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGH
Sbjct: 255 LNHPHVVRLESRPGGFDGTGVVTIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGH 314

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI 
Sbjct: 315 DGSMGTVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRIL 374

Query: 411 NICEIVGMEGNVIITQDLLKYEV 433
           +I E+ G+  N+I TQ+L +YE 
Sbjct: 375 SITEVTGLSDNIIATQELYRYEA 397


>gi|254245564|ref|ZP_04938885.1| Flp pilus assembly protein, ATPase CpaF [Burkholderia cenocepacia
           PC184]
 gi|124870340|gb|EAY62056.1| Flp pilus assembly protein, ATPase CpaF [Burkholderia cenocepacia
           PC184]
          Length = 457

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 252/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEIDSFVRLRRIPLNENEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N V++  +G   +  + F DN  LL 
Sbjct: 75  RTIAEALTKELAGFGPIEDLLADPAVEDILINGYNDVYVSRHGILAKLPVRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  +GRR+DES+P+ DARL DG RVNV+I PL++DGP ++IRKF+KD L    L+
Sbjct: 135 IVRRILAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSIDGPVVSIRKFRKDPLKPSDLL 194

Query: 231 SFGAVTAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQ 290
             G    E   LLQ     RCN+L+SGGT SGKT+LLN L  +I + ER+VT EDTAEL 
Sbjct: 195 GNGTFNEEINTLLQAAVEARCNILVSGGTSSGKTSLLNALAFHIPEIERVVTIEDTAELS 254

Query: 291 LQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGH 350
           L  PHVVRLE+RP   +G G +++RDL++N LRMRP+RII+GEVRG EVL++LQAMNTGH
Sbjct: 255 LNHPHVVRLESRPGGFDGTGVVSIRDLLRNTLRMRPDRIIVGEVRGGEVLEMLQAMNTGH 314

Query: 351 DGSMGTIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRIT 410
           DGSMGT+HA++ RE   R+E +    GF      +R  I +++D IVQ  RL +G RRI 
Sbjct: 315 DGSMGTVHASSPRECLYRLEMLAGFAGFQGTESSLRRQIANAIDFIVQIGRLSNGRRRIL 374

Query: 411 NICEIVGMEGNVIITQDLLKYEV 433
           +I E+ G+  N+I TQ+L +YE 
Sbjct: 375 SITEVTGLSDNIIATQELYRYEA 397


>gi|221066737|ref|ZP_03542842.1| type II secretion system protein E [Comamonas testosteroni KF-1]
 gi|220711760|gb|EED67128.1| type II secretion system protein E [Comamonas testosteroni KF-1]
          Length = 440

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 174/414 (42%), Positives = 262/414 (63%), Gaps = 8/414 (1%)

Query: 58  YYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQLDLFE 115
           Y E+K++ +  L+  I+    +  ++   +    +   ++  + +  + ++  E L +  
Sbjct: 23  YAELKNSTYEHLLNRIEELGAEFGRWSQAAIAQFVLMELDSFIRLHSVPVNEQEALLVAR 82

Query: 116 DLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRI 175
            L  ++ G GPLQPL+    + DI++NG   +++   G      ++F+D+E +L + +RI
Sbjct: 83  SLTRELTGLGPLQPLLEDAHVEDILINGYRNIYVSRGGMLQREDLHFKDDEHVLRIVRRI 142

Query: 176 VNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLVSFGAV 235
           +  +GRR+DESSP+ DARL DG R+NVII PL++DGP+++IRKF+KD LT   LVS G  
Sbjct: 143 LAPLGRRLDESSPMVDARLPDGGRINVIIAPLSIDGPSVSIRKFRKDPLTPAELVSLGTF 202

Query: 236 TAEGARLLQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTAELQLQQPH 295
            ++  R+L++  + RCN+L+SGGT SGKT+LLN L  +I   ERIV+ EDTAEL L   H
Sbjct: 203 NSDICRILEMAVQARCNILVSGGTSSGKTSLLNALASFIPSSERIVSIEDTAELSLNHSH 262

Query: 296 VVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMNTGHDGSMG 355
           VVRLE+RP   E  G++++RDL++N LRMRP+RII+GEVR  EVLDLLQAMNTGHDGSMG
Sbjct: 263 VVRLESRPGGFESLGQVSIRDLLRNSLRMRPDRIIVGEVRSGEVLDLLQAMNTGHDGSMG 322

Query: 356 TIHANNARESFGRMEAMIAMGGFTLPSQMVREIITSSLDVIVQTQRLRDGSRRITNICEI 415
           TIHA++ RE   R E +    GF      +R  I +++D +VQ  RL +G RR+ ++ E+
Sbjct: 323 TIHASSPRECLYRAEMLAGFAGFQGSEISLRRQIANAVDFVVQIGRLSNGRRRLISLTEV 382

Query: 416 VGMEGNVIITQDLLKYEVMGEDETGKLIGQHISTGVS--RPR---FWNRAAQYG 464
            GM  N+I  Q+L +YE     + G+ I   +S G+S   P+   +W    Q G
Sbjct: 383 TGMTDNMISMQELYRYEPQVTAD-GQEIDNWVSMGISPHSPKLLNWWRMQQQAG 435


>gi|325518467|gb|EGC98166.1| pilus assembly protein [Burkholderia sp. TJI49]
          Length = 452

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 251/383 (65%), Gaps = 2/383 (0%)

Query: 53  NRTPHYYEVKSTIFTTLIEMIDI--TQLSQYDSQSARDEIATLMNEIVSVKKITMSLDEQ 110
           ++T  ++++K+     L+  I+    +  ++  Q+    +   ++  V +++I ++ +E 
Sbjct: 15  SQTQQFHDIKNAAHEHLLTRIEELGAEFGRWSRQAINQFVDLEVDSFVRLRRIPLNENEV 74

Query: 111 LDLFEDLCNDILGYGPLQPLIARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLS 170
             + E L  ++ G+GP++ L+A   + DI++NG N V++  +G   +  + F DN  LL 
Sbjct: 75  RAIAEALTKELAGFGPIEDLLADPAVEDILINGYNDVYVSRHGILSKLPVRFTDNAHLLR 134

Query: 171 VCQRIVNQVGRRVDESSPICDARLLDGSRVNVIIPPLALDGPTLTIRKFKKDKLTLDHLV 230
           + +RI+  +GRR+DES+P+ DARL DG RVNV+I PL+L GP ++IRKF+KD L    L+
Sbjct: 135 IVRRILAPIGRRLDESNPMVDARLPDGGRVNVVIEPLSLAGPIVSIRKFRKDPLKPSDLL 194

Query: