RPSBLAST alignment for GI: 254780724 and conserved domain: TIGR02788

>gnl|CDD|163021 TIGR02788, VirB11, P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA. Length = 308
 Score =  217 bits (556), Expect = 4e-57
 Identities = 105/307 (34%), Positives = 163/307 (53%), Gaps = 27/307 (8%)

Query: 131 IARDDIADIMVNGSNKVFIEVNGKTVETGINFRDNEQLLSVCQRIVNQVGRRVDESSPIC 190
           +  +D+ +I +N   +V++E  G      +       L+ + + I +   + + E +PI 
Sbjct: 2   LDDEDVTEICINRPGEVWVEGPGGWQRFDVPDLTFSHLMRLARAIASFSKQSISEENPIL 61

Query: 191 DARLLDGSRVNVIIPPLAL-DGPTLTIRKFKKDKLTLDHLV---SFGAVTAEGARL---- 242
            A L  G RV ++IPP    D  ++TIRK      +LD       F  V A+   L    
Sbjct: 62  SATLPGGERVQIVIPPACENDTVSITIRKPSLVDFSLDDYEEKGFFDTVRAQSGTLSDND 121

Query: 243 ---------------LQIIGRIRCNVLISGGTGSGKTTLLNCLTRYIDKDERIVTCEDTA 287
                          L++    R N++ISGGTGSGKTT L  L   I KDERI+T EDT 
Sbjct: 122 EQLLELLDAGDIKEFLRLAIASRKNIIISGGTGSGKTTFLKSLVDEIPKDERIITIEDTR 181

Query: 288 ELQLQQPHVVRLETRPPNIEGEGEITMRDLVKNCLRMRPERIILGEVRGPEVLDLLQAMN 347
           E+ L  P+ V L       +G  ++T +DL+++CLRMRP+RIILGE+RG E  D ++A+N
Sbjct: 182 EIFLPHPNYVHL-FYSKGGQGLAKVTPKDLLQSCLRMRPDRIILGELRGDEAFDFIRAVN 240

Query: 348 TGHDGSMGTIHANNARESFGRMEAMI--AMGGFTLPSQMVREIITSSLDVIVQTQRLRDG 405
           TGH GS+ T+HA +  E+F ++  M+  +  G  L    + +++   +D++VQ  R R G
Sbjct: 241 TGHPGSITTLHAGSPEEAFEQLALMVKSSQAGLGLDFAYIVKLVREVIDIVVQINR-RGG 299

Query: 406 SRRITNI 412
            R+IT +
Sbjct: 300 GRKITEV 306