>cd01861 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate

Probab=95.69 E-value=0.16 Score=28.58 Aligned_cols=110 Identities=18% Similarity=0.174 Sum_probs=72.1 Q ss_pred HCCCEEEECCCCCCC--HHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHH Q ss_conf 128889973888889--899999862012543578-77688999999999999819876753899956589875200599 Q gi|254780725|r 273 QIFPLVILDVPHVWN--SWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISIS 349 (427) Q Consensus 273 ~~yd~VIiD~p~~~~--~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~ 349 (427) T Consensus 47 ~~~~l~i~D~~g~e~~~~~~~~~~~~~~~~ilvfd~t~~~Sf~~~~~w~~~i~~~~~~~~~ivlvGnK~Dl~~~r~v~~~ 126 (161) T cd01861 47 KTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFDNTDKWIDDVRDERGNDVIIVLVGNKTDLSDKRQVSTE 126 (161) T ss_pred EEEEEEEEECCCCHHHHHHHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCCCCHH T ss_conf 99999999799853157888988665258999984799899999999999999865789849996102110221778999 Q ss_pred HHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHH Q ss_conf 99998489537990687999999884796189888999--8999999999998 Q gi|254780725|r 350 DFCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVL 400 (427) Q Consensus 350 ~~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i 400 (427) T Consensus 127 e------------------~~~~a~~~~~~y~E~Sak~~~nV~e~F~~la~~l 161 (161) T cd01861 127 E------------------GEKKAKELNAMFIETSAKAGHNVKELFRKIASAL 161 (161) T ss_pred H------------------HHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHC T ss_conf 9------------------9999998499899983477808899999999709

HHsearch alignment for GI: 254780725 and conserved domain: cd01861