>cd01864 Rab19 Rab19 subfamily. Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

Probab=91.04 E-value=0.73 Score=24.46 Aligned_cols=109 Identities=14% Similarity=0.189 Sum_probs=69.0 Q ss_pred CCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCC-CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHH Q ss_conf 2888997388888--9899999862012543578-776889999999999998198767538999565898752005999 Q gi|254780725|r 274 IFPLVILDVPHVW--NSWTQEVLTLSDKVVITTS-LDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISD 350 (427) Q Consensus 274 ~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~-p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~ 350 (427) T Consensus 51 ~~~l~iwDtaG~e~~~~l~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVGNK~DL~~~r~V~~~~ 130 (165) T cd01864 51 RVKLQIWDTAGQERFRTITQSYYRSANGAIIAYDITRRSSFESVPHWIEEVEKYGASNVVLLLIGNKCDLEEQREVLFEE 130 (165) T ss_pred EEEEEEEECCCCCCCCCCCHHHEECCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCCCCHHH T ss_conf 99999998999834453507552215666997138998999999999999998769998438887723768628999999 Q ss_pred HHHHHCCCEEEEECCCHHHHHHHHHCCCC-EEEECCCC--HHHHHHHHHHHHH Q ss_conf 99984895379906879999998847961-89888999--8999999999998 Q gi|254780725|r 351 FCAPLGITPSAIIPFDGAVFGMSANSGKM-IHEVDPKS--AIANLLVDFSRVL 400 (427) Q Consensus 351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~p-i~e~~p~s--~~a~~~~~La~~i 400 (427) T Consensus 131 ~------------------~~~a~~~~~~~~~E~SAk~~~nV~e~F~~la~~i 165 (165) T cd01864 131 A------------------CTLAEKNGMLAVLETSAKESQNVEEAFLLMATEL 165 (165) T ss_pred H------------------HHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHC T ss_conf 9------------------9999983997699978885819899999999849

HHsearch alignment for GI: 254780725 and conserved domain: cd01864