>cd01884 EF_Tu EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.

Probab=92.42 E-value=0.39 Score=26.12 Aligned_cols=67 Identities=9% Similarity=0.020 Sum_probs=49.6 Q ss_pred CCCEEEECCCCCCC--HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC Q ss_conf 28889973888889--8999998620125435787768899999999999981987675389995658987 Q gi|254780725|r 274 IFPLVILDVPHVWN--SWTQEVLTLSDKVVITTSLDLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPK 342 (427) Q Consensus 274 ~yd~VIiD~p~~~~--~~~~~~L~~AD~vviV~~p~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~ 342 (427) T Consensus 64 ~~~~~~IDtPGH~dF~~~~i~g~~~~D~aiLVVdA~eGv~~QT~eh~~la~~lgi--~~iiV~iNK~D~~~ 132 (195) T cd01884 64 NRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGV--PYIVVFLNKADMVD 132 (195) T ss_pred CEEEEECCCCCHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCC--CCEEEEEECCCCCC T ss_conf 8169962689607788899863511362689985277874789999999998099--96279996877898

HHsearch alignment for GI: 254780725 and conserved domain: cd01884