>cd04114 Rab30 Rab30 subfamily. Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

Probab=95.91 E-value=0.13 Score=29.13 Aligned_cols=110 Identities=17% Similarity=0.178 Sum_probs=73.8 Q ss_pred CCCEEEECCCCCC--CHHHHHHHHHCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHH Q ss_conf 2888997388888--98999998620125435787-76889999999999998198767538999565898752005999 Q gi|254780725|r 274 IFPLVILDVPHVW--NSWTQEVLTLSDKVVITTSL-DLAGLRNSKNLIDVLKKLRPADKPPYLVLNQVKTPKKPEISISD 350 (427) Q Consensus 274 ~yd~VIiD~p~~~--~~~~~~~L~~AD~vviV~~p-~~~slr~a~~ll~~l~~~~~~~~~~~iVlNr~~~~~~~~i~~~~ 350 (427) T Consensus 55 ~v~l~iwDtaG~e~~~~l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVGNK~DL~~~r~v~~~~ 134 (169) T cd04114 55 KIKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANNKVITILVGNKIDLAERREVSQQR 134 (169) T ss_pred EEEEEEEECCCCCCCCCCHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHCCCCCHHH T ss_conf 99999998999844451557774236645998148988899999999999998689886389731134345417889999 Q ss_pred HHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCC--HHHHHHHHHHHHHH Q ss_conf 9998489537990687999999884796189888999--89999999999985 Q gi|254780725|r 351 FCAPLGITPSAIIPFDGAVFGMSANSGKMIHEVDPKS--AIANLLVDFSRVLM 401 (427) Q Consensus 351 ~~~~lg~~~~~~IP~D~~~~~~A~~~G~pi~e~~p~s--~~a~~~~~La~~i~ 401 (427) T Consensus 135 ~------------------~~~a~~~~~~~~E~SAktg~nV~e~F~~la~~li 169 (169) T cd04114 135 A------------------EEFSDAQDMYYLETSAKESDNVEKLFLDLACRLI 169 (169) T ss_pred H------------------HHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHC T ss_conf 9------------------9999988999999868988088999999999879

HHsearch alignment for GI: 254780725 and conserved domain: cd04114